Pallidin Homolog (Mouse) (PLDN) (Middle Region) antibody

Details for Product No. ABIN406445
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms BLOC-1, Pldn, Stx13bp1, pa, BLOS6, HPS9, PA, PALLID, PLDN, pallidin, CG14133, Dmel\\CG14133, LOC100226487, pldn
Epitope
Middle Region
(3), (2), (2), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Pig (Porcine), Cow (Bovine), Dog (Canine), Human, Chicken
(22), (7), (5), (2), (2)
Host
Rabbit
(12), (7), (6)
Clonality
Polyclonal
Application
Western Blotting (WB)
(23), (10), (8), (2), (1), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN406445
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human PLDN
Sequence EGLIEDLTIEDKAVEQLAEGLLSHYLPDLQRSKQALQELT QNQVVLLDTL
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Goat : 100 %, Guinea pig : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, Rat : 100 %, Chicken : 90 %
Characteristics This is a rabbit polyclonal antibody against PLDN. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name PLDN
Background PLDN may play a role in intracellular vesicle trafficking. It interacts with Syntaxin 13 which mediates intracellular membrane fusion.The protein encoded by this gene may play a role in intracellular vesicle trafficking. It interacts with Syntaxin 13 which mediates intracellular membrane fusion. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.
Molecular Weight 20 kDa
Gene ID 26258
NCBI Accession NM_012388, NP_036520
UniProt Q9UL45
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 172 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Pallidin Homolog (Mouse) (PLDN) (Middle Region) antibody WB Suggested Anti-PLDN Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Jurkat cell lysate
Background publications Stelzl, Worm, Lalowski et al.: "A human protein-protein interaction network: a resource for annotating the proteome...." in: Cell, Vol. 122, Issue 6, pp. 957-68, 2005 (PubMed).

Hosts (12), (7), (6)
Reactivities (22), (7), (5), (2), (2)
Applications (23), (10), (8), (2), (1), (1), (1)
Epitopes (3), (2), (2), (1), (1)
back to top