Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406445

Pallidin Homolog (Mouse) (PLDN) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms BLOC-1, Pldn, Stx13bp1, pa, BLOS6, HPS9, PA, PALLID, PLDN, pallidin, CG14133, Dmel\\CG14133, LOC100226487, pldn
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Pig (Porcine), Cow (Bovine), Dog (Canine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN406445
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-PLDN antibody: synthetic peptide directed towards the middle region of human PLDN
Sequence EGLIEDLTIEDKAVEQLAEGLLSHYLPDLQRSKQALQELT QNQVVLLDTL
Predicted Reactivity Bovine : 100%, Dog : 100%, Goat : 100%, Guinea pig : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%, Chicken : 92%
Characteristics This is a rabbit polyclonal antibody against PLDN. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name PLDN
Background PLDN may play a role in intracellular vesicle trafficking. It interacts with Syntaxin 13 which mediates intracellular membrane fusion.The protein encoded by this gene may play a role in intracellular vesicle trafficking. It interacts with Syntaxin 13 which mediates intracellular membrane fusion. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.
Molecular Weight 20kDa
Gene ID 26258
NCBI Accession NP_036520, NM_012388
UniProt Q9UL45
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-PLDN antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Stelzl, Worm, Lalowski et al.: "A human protein-protein interaction network: a resource for annotating the proteome." in: Cell, Vol. 122, Issue 6, pp. 957-68, 2005 (PubMed).

Alternatives for antigen "Pallidin Homolog (Mouse) (PLDN)", type "Antibodies"
Hosts (10), (7), (7)
Reactivities (21), (6), (4), (2), (2)
Applications (22), (11), (6), (2), (1), (1), (1), (1)
Epitopes (3), (2), (2), (1), (1)
Beacon