Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406492

Chromosome 18 Open Reading Frame 10 (C18orf10) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C18orf10, L17, PGs2, CZH18orf10, c18orf10, 5730437P09Rik, 5730494M16Rik, AI666318, Pgs2, RGD1310571, DKFZp468A177
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Xenopus laevis, Zebrafish (Danio rerio), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN406492
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-C18orf10 antibody: synthetic peptide directed towards the middle region of human C18orf10
Sequence LYWHFLTDTFTAYYRLLITHLGLPQWQYAFTSYGISPQAK QWFSMYKPIT
Predicted Reactivity Rabbit : 100%
Characteristics This is a rabbit polyclonal antibody against C18orf10. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name C18orf10
Background The function of C18orf10 remains unknown.
Molecular Weight 33kDa
Gene ID 25941
NCBI Accession NP_056291, NM_015476
UniProt Q68CL5
Research Area Signaling, Cytoskeleton
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-C18orf10 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Petroziello, Yamane, Westendorf et al.: "Suppression subtractive hybridization and expression profiling identifies a unique set of genes overexpressed in non-small-cell lung cancer." in: Oncogene, Vol. 23, Issue 46, pp. 7734-45, 2004 (PubMed).

Alternatives for antigen "Chromosome 18 Open Reading Frame 10 (C18orf10)", type "Antibodies"
Hosts (11), (2)
Reactivities (10), (2), (1), (1), (1), (1), (1), (1)
Applications (13), (3), (3), (2), (2)
Epitopes (3), (2), (2), (2), (2), (1), (1), (1)
Beacon