Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406545

Transmembrane Protein 146 (TMEM146) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms TMEM146, 4921529N20Rik, 4933402B14Rik, 619718, AW045609, Gm6095, Tmem146
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN406545
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TMEM146 antibody: synthetic peptide directed towards the N terminal of human TMEM146
Sequence LIQDVQGDRLYFHPTTTRLIKHPCEKNIALYLGKQVFFTM DNFETSLLPF
Predicted Reactivity Human :100%,   Planctomyces maris DSM 8797 :90%,   Crab-eating macaque :85%,  
Characteristics This is a rabbit polyclonal antibody against TMEM146. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name TMEM146
Background TMEM146 is a single-pass type I membrane protein. The functions of TMEM146 remain unknown.
Molecular Weight 90kDa
Gene ID 257062
NCBI Accession NP_689997, NM_152784
UniProt Q86XM0
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TMEM146 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Strausberg, Feingold, Grouse et al.: "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 99, Issue 26, pp. 16899-903, 2002 (PubMed).

Alternatives for antigen "Transmembrane Protein 146 (TMEM146)", type "Antibodies"
Hosts (5)
Reactivities (3)
Applications (5), (2)
Epitopes (1), (1), (1)
Beacon