TMEM146 antibody (N-Term)

Catalog No. ABIN635627

Product Details anti-TMEM146 Antibody

Target: TMEM146 (Transmembrane Protein 146 (TMEM146))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMEM146 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TMEM146 antibody was raised against the N terminal of TMEM146

Purification: Affinity purified

Immunogen: TMEM146 antibody was raised using the N terminal of TMEM146 corresponding to a region with amino acids LIQDVQGDRLYFHPTTTRLIKHPCEKNIALYLGKQVFFTMDNFETSLLPF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMEM146 Blocking Peptide, catalog no. 33R-5061, is also available for use as a blocking control in assays to test for specificity of this TMEM146 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM146 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMEM146

Target: TMEM146 (Transmembrane Protein 146 (TMEM146))

Alternative Name: TMEM146 (TMEM146 Products)

Synonyms: TMEM146 antibody, 4921529N20Rik antibody, 4933402B14Rik antibody, 619718 antibody, AW045609 antibody, Gm6095 antibody, Tmem146 antibody, cation channel sperm associated auxiliary subunit delta antibody, CATSPERD antibody, Catsperd antibody

Background: TMEM146 is a single-pass type I membrane protein. The functions of TMEM146 remain unknown.

Molecular Weight: 90 kDa (MW of target protein)