Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406567

Family with Sequence Similarity 98, Member B (FAM98B) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 2610510H03Rik, RGD1564603
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN406567
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-FAM98B antibody: synthetic peptide directed towards the N terminal of human FAM98B
Sequence LTKAAEGGLSSPEFSELCIWLGSQIKSLCNLEESITSAGR DDLESFQLEI
Predicted Reactivity Bovine : 100%, Dog : 100%, Human : 100%, Mouse : 100%, Rabbit : 100%, Guinea pig : 92%, Pig : 82%
Characteristics This is a rabbit polyclonal antibody against FAM98B. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name FAM98B
Background The specific function of FAM98B is not yet known.
Molecular Weight 45kDa
Gene ID 283742
NCBI Accession NP_775882, NM_173611
UniProt A8MUW5
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-FAM98B antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Tsuritani, Irie, Yamashita et al.: "Distinct class of putative "non-conserved" promoters in humans: comparative studies of alternative promoters of human and mouse genes." in: Genome research, Vol. 17, Issue 7, pp. 1005-14, 2007 (PubMed).

Alternatives for antigen "Family with Sequence Similarity 98, Member B (FAM98B)", type "Antibodies"
Hosts (19)
Reactivities (17), (12), (12), (12), (11), (11)
Applications (10), (9), (3), (3), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (3), (1)
Beacon