Calcyphosine (CAPS) (N-Term) antibody

Details for Product No. ABIN406689
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms CAPS1, 1700028N11Rik, AW125205, caps1, MGC84373, CAPS
Epitope
N-Term
(3), (1), (1)
Reactivity
Rabbit, Human
(25), (12), (12), (12), (12), (12)
Host
Rabbit
(21), (5)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(16), (10), (9), (7), (4), (2), (2), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN406689
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human CAPS
Sequence DAVDATMEKLRAQCLSRGASGIQGLARFFRQLDRDGSRSL DADEFRQGLA
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against CAPS. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name CAPS
Background CAPS is a calcium-binding protein, which may play a role in the regulation of ion transport. A similar protein was first described as a potentially important regulatory protein in the dog thyroid and was termed as R2D5 antigen in rabbit.This gene encodes a calcium-binding protein, which may play a role in the regulation of ion transport. A similar protein was first described as a potentially important regulatory protein in the dog thyroid and was termed as R2D5 antigen in rabbit. Alternative splicing of this gene generates two transcript variants.
Molecular Weight 21 kDa
Gene ID 828
NCBI Accession NM_004058, NP_004049
UniProt Q13938
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 189 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Calcyphosine (CAPS) (N-Term) antibody WB Suggested Anti-CAPS Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T cell lysate
anti-Calcyphosine (CAPS) (N-Term) antibody (2) Sample Type: Huh7 HepG2 (50ug)
Primary Antibody Dilution:1:500
Image Submitted By: Partha Kasturi
University of Kansas Medical Center
Background publications Grimwood, Gordon, Olsen et al.: "The DNA sequence and biology of human chromosome 19." in: Nature, Vol. 428, Issue 6982, pp. 529-35, 2004 (PubMed).

Hosts (21), (5)
Reactivities (25), (12), (12), (12), (12), (12)
Applications (16), (10), (9), (7), (4), (2), (2), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (3), (1), (1)
back to top