Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

ER Lipid Raft Associated 2 (ERLIN2) antibody

Antigen

ER Lipid Raft Associated 2 (ERLIN2)
Synonyms NET32, SPFH2, C8orf2, Erlin-2, MGC87072, MGC137889
Clonality Polyclonal
Host
Alternatives

Rabbit
Reactivity
Alternatives

Fruit Fly (Drosophila melanogaster), Human, Rat (Rattus), Mouse (Murine), Pig (Porcine)
Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN406694
Quantity 50 µg
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

anti-ER Lipid Raft Associated 2 (ERLIN2) antibody

anti-ER Lipid Raft Associated 2 (ERLIN2) antibody (2)

Additional Information
Application Details Publications Images Alternatives back to top

Alternative name Erlin-2
Gene ID ERLIN2
UniProt O94905
Immunogen The immunogen for anti-ERLIN2 antibody: synthetic peptide directed towards the middle region of human ERLIN2
Sequence ASNSKIYFGKDIPNMFMDSAGSVSKQFEGLADKLSFGLED EPLETATKEN
Cross-Reactivity Fruit Fly (Drosophila melanogaster), Human, Mouse (Murine), Pig (Porcine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-ERLIN2 antibody concentration is 1 mg/ml.
Description ERLIN2 plays an important role in the early steps of the endoplasmic reticulum-associated degradation (ERAD) pathway. It is involved in ITPR1 degradation by the ERAD pathway.
Characteristics Antigen Size: 339 amino acids
Molecular Weight 38kDa

Application Details
Publications Images Alternatives back to top

Application Notes WB Suggested Anti-ERLIN2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 293T cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications
Application Details Images Alternatives back to top

Product Pearce, Wang, Kelley et al.: "SPFH2 mediates the endoplasmic reticulum-associated degradation of inositol 1,4,5-trisphosphate receptors and other substrates in mammalian cells." in: The Journal of biological chemistry, Vol. 282, Issue 28, pp. 20104-15, 2007 (PubMed).

Alternatives
Application Details Publications Images back to top

Alternatives for antigen "ER Lipid Raft Associated 2 (ERLIN2)", type "Antibodies"
Hosts Rabbit (28), Goat (4)
Reactivities Human (30), Mouse (Murine) (23), Rat (Rattus) (22), Chicken (19), Cow (Bovine) (19), Dog (Canine) (19), Horse (Equine) (18), Pig (Porcine) (18), Rabbit (18), Sheep (Ovine) (18), Cat (Feline) (1)
Applications Immunofluorescence (IF) (16), Western Blotting (WB) (16), ELISA (11), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (5), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunocytochemistry (ICC) (2), Immunohistochemistry (IHC) (2), Immunoelectron Microscopy (IEM) (1), Immunohistochemistry (Frozen Sections) (IHC (fro)) (1), Immunoprecipitation (IP) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1), Un-conjugated (1)
Epitopes C-Term (2), Internal Region (1)