Actin Related Protein 2/3 Complex, Subunit 2, 34kDa (ARPC2) antibody

Antigen: Actin Related Protein 2/3 Complex, Subunit 2, 34kDa (ARPC2)

Synonyms: ARC34, PRO2446, p34-Arc, PNAS-139, arc34, p34-arc, pro2446, MGC69338, pnas-139, ARPC2, MGC126898, Arpc2, Arc-p34, DKFZp459D1927, MGC154528

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Xenopus laevis, Pig (Porcine)

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN406714

Additional Information

Alternative name: ARPC2 / ARC34

Gene ID: ARPC2

UniProt: O15144

Immunogen: The immunogen for anti-ARPC2 antibody: synthetic peptide directed towards the N terminal of human ARPC2

Sequence: MVLNVYCCFFQISDIQTMKINQTILKEFILVGFSVYPHVQ TFLFVVFFCL

Cross-Reactivity: Cow (Bovine), Human, Mouse (Murine), Pig (Porcine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-ARPC2 antibody concentration is 1 mg/ml.

Description: ARPC2 is one of seven subunits of the human Arp2/3 protein complex. The Arp2/3 protein complex has been implicated in the control of actin polymerization in cells and has been conserved through evolution. The exact role of ARPC2, the p34 subunit, has yet to be determined. This gene encodes one of seven subunits of the human Arp2/3 protein complex. The Arp2/3 protein complex has been implicated in the control of actin polymerization in cells and has been conserved through evolution. The exact role of the protein encoded by this gene, the p34 subunit, has yet to be determined. Two alternatively spliced variants have been characterized to date. Additional alternatively spliced variants have been described but their full length nature has not been determined.

Characteristics: Antigen Size: 300 amino acids

Molecular Weight: 33kDa

Application Details

Application Notes: WB Suggested Anti-ARPC2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human brain.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-ARPC2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human brain

Publications

Product: Cai, Marshall, Uetrecht et al.: "Coronin 1B coordinates Arp2/3 complex and cofilin activities at the leading edge." in: Cell, Vol. 128, Issue 5, pp. 915-29, 2007 (PubMed).