Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406731

Tissue Specific Transplantation Antigen P35B (TSTA3) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms FX, P35B, SDR4E1, AI256181, Tstap35b, p35b, sdr4e1, wu:fe16c04, TSTA3, zgc:101805, si:dkey-235d18none
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN406731
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TSTA3 antibody: synthetic peptide directed towards the N terminal of human TSTA3
Sequence MGEPQGSMRILVTGGSGLVGKAIQKVVADGAGLPGEDWVF VSSKDADLTD
Predicted Reactivity Dog : 100%, Guinea pig : 100%, Human : 100%, Mouse : 100%, Rabbit : 100%, Rat : 100%, Horse : 92%, Bovine : 85%
Characteristics This is a rabbit polyclonal antibody against TSTA3. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name TSTA3
Background Tissue specific transplantation antigen P35B is a NADP(H)-binding protein. It catalyze the two-step epimerase and the reductase reactions in GDP-D-mannose metabolism, converting GDP-4-keto-6-D-deoxymannose to GDP-L-fucose. GDP-L-fucose is the substrate of several fucosyltransferases involved in the expression of many glycoconjugates, including blood group ABH antigens and developmental adhesion antigens. Mutations in this gene may cause leukocyte adhesion deficiency, type II.Tissue specific transplantation antigen P35B is a NADP(H)-binding protein. It catalyze the two-step epimerase and the reductase reactions in GDP-D-mannose metabolism, converting GDP-4-keto-6-D-deoxymannose to GDP-L-fucose. GDP-L-fucose is the substrate of several fucosyltransferases involved in the expression of many glycoconjugates, including blood group ABH antigens and developmental adhesion antigens. Mutations in this gene may cause leukocyte adhesion deficiency, type II.
Molecular Weight 35kDa
Gene ID 7264
NCBI Accession NP_003304, NM_003313
UniProt Q13630
Research Area Signaling, Metabolism
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TSTA3 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Roos, Kolmer, Mattila et al.: "Composition of Drosophila melanogaster proteome involved in fucosylated glycan metabolism." in: The Journal of biological chemistry, Vol. 277, Issue 5, pp. 3168-75, 2002 (PubMed).

Alternatives for antigen "Tissue Specific Transplantation Antigen P35B (TSTA3)", type "Antibodies"
Hosts (25), (6)
Reactivities (27), (16), (12)
Applications (31), (20), (4), (2), (1)
Conjugates (1), (1), (1)
Epitopes (7), (3), (2), (2), (1), (1), (1), (1)
Beacon