Tissue Specific Transplantation Antigen P35B (TSTA3) (N-Term) antibody

Details for Product No. ABIN406731
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms FX, P35B, SDR4E1, AI256181, Tstap35b, p35b, sdr4e1, wu:fe16c04, TSTA3, zgc:101805, si:dkey-235d18none
Epitope
N-Term
(5), (3), (2), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human
(29), (16), (14)
Host
Rabbit
(24), (7)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(31), (19), (4), (3), (2)
Pubmed 1 reference available
Catalog no. ABIN406731
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human TSTA3
Sequence MGEPQGSMRILVTGGSGLVGKAIQKVVADGAGLPGEDWVF VSSKDADLTD
Predicted Reactivity Dog : 100 %, Guinea pig : 100 %, Human : 100 %, Mouse : 100 %, Rabbit : 100 %, Rat : 100 %, Horse : 90 %, Bovine : 80 %
Characteristics This is a rabbit polyclonal antibody against TSTA3. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name TSTA3
Background Tissue specific transplantation antigen P35B is a NADP(H)-binding protein. It catalyze the two-step epimerase and the reductase reactions in GDP-D-mannose metabolism, converting GDP-4-keto-6-D-deoxymannose to GDP-L-fucose. GDP-L-fucose is the substrate of several fucosyltransferases involved in the expression of many glycoconjugates, including blood group ABH antigens and developmental adhesion antigens. Mutations in this gene may cause leukocyte adhesion deficiency, type II.Tissue specific transplantation antigen P35B is a NADP(H)-binding protein. It catalyze the two-step epimerase and the reductase reactions in GDP-D-mannose metabolism, converting GDP-4-keto-6-D-deoxymannose to GDP-L-fucose. GDP-L-fucose is the substrate of several fucosyltransferases involved in the expression of many glycoconjugates, including blood group ABH antigens and developmental adhesion antigens. Mutations in this gene may cause leukocyte adhesion deficiency, type II.
Molecular Weight 35 kDa
Gene ID 7264
NCBI Accession NM_003313, NP_003304
UniProt Q13630
Research Area Signaling, Metabolism
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 321 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Tissue Specific Transplantation Antigen P35B (TSTA3) (N-Term) antibody WB Suggested Anti-TSTA3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: MCF7 cell lysate
Background publications Roos, Kolmer, Mattila et al.: "Composition of Drosophila melanogaster proteome involved in fucosylated glycan metabolism." in: The Journal of biological chemistry, Vol. 277, Issue 5, pp. 3168-75, 2002 (PubMed).

Hosts (24), (7)
Reactivities (29), (16), (14)
Applications (31), (19), (4), (3), (2)
Conjugates (1), (1), (1)
Epitopes (5), (3), (2), (1), (1), (1), (1)
back to top