TSTA3 antibody (N-Term)

Catalog No. ABIN634621

Product Details anti-TSTA3 Antibody

Target: TSTA3 (Tissue Specific Transplantation Antigen P35B (TSTA3))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TSTA3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TSTA3 antibody was raised against the N terminal of TSTA3

Purification: Affinity purified

Immunogen: TSTA3 antibody was raised using the N terminal of TSTA3 corresponding to a region with amino acids MGEPQGSMRILVTGGSGLVGKAIQKVVADGAGLPGEDWVFVSSKDADLTD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TSTA3 Blocking Peptide, catalog no. 33R-6023, is also available for use as a blocking control in assays to test for specificity of this TSTA3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSTA3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TSTA3

Target: TSTA3 (Tissue Specific Transplantation Antigen P35B (TSTA3))

Alternative Name: TSTA3 (TSTA3 Products)

Synonyms: FX antibody, P35B antibody, SDR4E1 antibody, AI256181 antibody, Tstap35b antibody, p35b antibody, sdr4e1 antibody, TSTA3 antibody, zgc:101805 antibody, si:dkey-235d18none antibody, Fx antibody, tissue specific transplantation antigen P35B antibody, tissue specific transplantation antigen P35B L homeolog antibody, TSTA3 antibody, Tsta3 antibody, tsta3 antibody, tsta3.L antibody

Background: Tissue specific transplantation antigen P35B is a NADP(H)-binding protein. It catalyze the two-step epimerase and the reductase reactions in GDP-D-mannose metabolism, converting GDP-4-keto-6-D-deoxymannose to GDP-L-fucose. GDP-L-fucose is the substrate of several fucosyltransferases involved in the expression of many glycoconjugates, including blood group ABH antigens and developmental adhesion antigens. Mutations in this gene may cause leukocyte adhesion deficiency, type II.

Molecular Weight: 35 kDa (MW of target protein)