Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406781

Engrailed 1 (EN1) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms en-1, en1, en1-A, eng1, engrailed-1, xen1, En-1, Mo-en.1
Reactivity
»Alternatives Chicken, Human, Mouse (Murine), Zebrafish, Xenopus laevis
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN406781
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-EN1 antibody: synthetic peptide directed towards the C terminal of human EN1
Sequence LMGSANGGPVVKTDSQQPLVWPAWVYCTRYSDRPSSGPRT RKLKKKKNEK
Cross-Reactivity Chicken, Human, Mouse (Murine)
Predicted Reactivity Guinea pig : 93%, Pig : 93%, African clawed frog : 92%, Rabbit : 86%
Characteristics Antigen Size: 392 amino acids
Purification Affinity Purified
Alternative Name Engrailed-1 / EN1
Background Homeobox-containing genes are thought to have a role in controlling development. In Drosophila, the 'engrailed' (en) gene plays an important role during development in segmentation, where it is required for the formation of posterior compartments. Different mutations in the mouse homologs, En1 and En2, produced different developmental defects that frequently are lethal. The human engrailed homologs 1 and 2 encode homeodomain-containing proteins and have been implicated in the control of pattern formation during development of the central nervous system.Homeobox-containing genes are thought to have a role in controlling development. In Drosophila, the 'engrailed' (en) gene plays an important role during development in segmentation, where it is required for the formation of posterior compartments. Different mutations in the mouse homologs, En1 and En2, produced different developmental defects that frequently are lethal. The human engrailed homologs 1 and 2 encode homeodomain-containing proteins and have been implicated in the control of pattern formation during development of the central nervous system.
Molecular Weight 40kDa
Gene ID EN1
UniProt Q05925
Application Notes WB Suggested Anti-EN1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate.
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µl of distilled water
Buffer Final anti-EN1 antibody concentration is 1 mg/ml.
Storage 4 °C
Storage Comment Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen. For longer periods of storage, store at -20°C
Background publications Atit, Sgaier, Mohamed et al.: "Beta-catenin activation is necessary and sufficient to specify the dorsal dermal fate in the mouse." in: Developmental biology, Vol. 296, Issue 1, pp. 164-76, 2006 (PubMed).

Alternatives for antigen "Engrailed 1 (EN1)", type "Antibodies"
Hosts (18), (5)
Reactivities (23), (14), (12), (12), (12), (12), (12)
Applications (13), (12), (10), (9), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (3), (2), (1), (1), (1), (1)
Beacon