Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN486856

Distal-Less Homeobox 3 (DLX3) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms AI4, TDO, Dlx-3, AV237891, DLX3, ai4, tdo, xdlx3, MGC69301
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN486856
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-DLX3 antibody: synthetic peptide directed towards the N terminal of human DLX3
Sequence LAGTGAYSPKSEYTYGASYRQYGAYREQPLPAQDPVSVKE EPEAEVRMVN
Predicted Reactivity Dog : 100%, Human : 100%, Bovine : 92%, Mouse : 92%, Rat : 92%, Sheep : 92%, Guinea pig : 85%
Characteristics This is a rabbit polyclonal antibody against DLX3. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name DLX3
Background DLX3 is a member of the Dlx gene family which contains a homeobox that is related to that of Distal-less (Dll), a gene expressed in the head and limbs of the developing fruit fly. The Distal-less homeo box(Dlx) family of genes comprises at least 6 different members, DLX1-DLX6. Trichodentoosseous syndrome (TDO), an autosomal dominant condition, has been correlated with DLX3 gene mutation. Mutations in this gene have been associated with the autosomal dominant conditions trichodentoosseous syndrome and amelogenesis imperfecta with taurodontism.Many vertebrate homeo box-containing genes have been identified on the basis of their sequence similarity with Drosophila developmental genes. Many vertebrate homeo box-containing genes have been identified on the basis of their sequence similarity with Drosophila developmental genes. Members of the Dlx gene family contain a homeobox that is related to that of Distal-less (Dll), a gene expressed in the head and limbs of the developing fruit fly. The Distal-less (Dlx) family of genes comprises at least 6 different members, DLX1-DLX6. Trichodentoosseous syndrome (TDO), an autosomal dominant condition, has been correlated with DLX3 gene mutation. This gene is located in a tail-to-tail configuration with another member of the gene family on the long arm of chromosome 17. Mutations in this gene have been associated with the autosomal dominant conditions trichodentoosseous syndrome and amelogenesis imperfecta with taurodontism.
Molecular Weight 32kDa
Gene ID 1747
NCBI Accession NP_005211, NM_005220
UniProt O60479
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-DLX3 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Lee, Lee, Lee et al.: "DLX3 mutation in a new family and its phenotypic variations." in: Journal of dental research, Vol. 87, Issue 4, pp. 354-7, 2008 (PubMed).

Alternatives for antigen "Distal-Less Homeobox 3 (DLX3)", type "Antibodies"
Hosts (20), (9), (1)
Reactivities (30), (16), (4), (3), (3), (1), (1), (1)
Applications (30), (19), (10), (6), (1), (1), (1)
Epitopes (7), (3), (2), (2), (1), (1), (1)
Beacon