Did you know that you can buy products from over 140 different suppliers from us?

Distal-Less Homeobox 3 (DLX3) (N-Term) antibody

Details for Product No. ABIN486856
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms DLX3, ai4, tdo, xdlx3, MGC69301, AI4, TDO, AV237891, Dlx-3
Epitope
N-Term
(9), (6), (3), (3), (2), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human
(40), (19), (4), (2), (2), (1)
Host
Rabbit
(25), (15)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(40), (24), (17), (3), (2), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN486856
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human DLX3
Sequence LAGTGAYSPKSEYTYGASYRQYGAYREQPLPAQDPVSVKE EPEAEVRMVN
Predicted Reactivity Dog : 100 %, Human : 100 %, Bovine : 90 %, Mouse : 90 %, Rat : 90 %, Sheep : 90 %, Guinea pig : 80 %
Characteristics This is a rabbit polyclonal antibody against DLX3. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name DLX3
Background DLX3 is a member of the Dlx gene family which contains a homeobox that is related to that of Distal-less (Dll), a gene expressed in the head and limbs of the developing fruit fly. The Distal-less homeo box(Dlx) family of genes comprises at least 6 different members, DLX1-DLX6. Trichodentoosseous syndrome (TDO), an autosomal dominant condition, has been correlated with DLX3 gene mutation. Mutations in this gene have been associated with the autosomal dominant conditions trichodentoosseous syndrome and amelogenesis imperfecta with taurodontism.Many vertebrate homeo box-containing genes have been identified on the basis of their sequence similarity with Drosophila developmental genes. Many vertebrate homeo box-containing genes have been identified on the basis of their sequence similarity with Drosophila developmental genes. Members of the Dlx gene family contain a homeobox that is related to that of Distal-less (Dll), a gene expressed in the head and limbs of the developing fruit fly. The Distal-less (Dlx) family of genes comprises at least 6 different members, DLX1-DLX6. Trichodentoosseous syndrome (TDO), an autosomal dominant condition, has been correlated with DLX3 gene mutation. This gene is located in a tail-to-tail configuration with another member of the gene family on the long arm of chromosome 17. Mutations in this gene have been associated with the autosomal dominant conditions trichodentoosseous syndrome and amelogenesis imperfecta with taurodontism.
Molecular Weight 32 kDa
Gene ID 1747
NCBI Accession NM_005220, NP_005211
UniProt O60479
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 287 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Distal-Less Homeobox 3 (DLX3) (N-Term) antibody WB Suggested Anti-DLX3 Antibody Titration: 0.2-1 ug/ml
Positive Control: MCF7 cell lysate
Background publications Lee, Lee, Lee et al.: "DLX3 mutation in a new family and its phenotypic variations." in: Journal of dental research, Vol. 87, Issue 4, pp. 354-7, 2008 (PubMed).

Validation Images
back to top