Zinc Finger E-Box Binding Homeobox 1 (ZEB1) antibody

Antigen: Zinc Finger E-Box Binding Homeobox 1 (ZEB1)

Synonyms: BZP, ZEB, TCF8, AREB6, NIL2A, ZFHEP, NIL-2A, ZFHX1A, NIL-2-A, DELTA-EF1, MGC133261, MEB1, Nil2, Tcf8, Tcf18, Zfhep, Zfx1a, Zfhx1a, Zfx1ha, [delta]EF1, 3110032K11Rik, deltaEF1, zfhx1, kheper, ZFH/[d]EF1, bzp, zeb, tcf8, areb6, nil2a, zfhep, nil-2a, MGC82910, ZEB1, zfhx1a, nil-2-a, MGC97552, DKFZp469P2021

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Chicken, Dog (Canine), Xenopus laevis

Conjugate: Un-conjugated

Application: Western Blotting (WB), Immunofluorescence (IF)

Catalog no.: ABIN486932

Additional Information

Alternative name: ZEB1

Gene ID: ZEB1

UniProt: P37275

Immunogen: The immunogen for anti-ZEB1 antibody: synthetic peptide directed towards the N terminal of human ZEB1

Sequence: KDDECESDAENEQNHDPNVEEFLQQQDTAVIFPEAPEEDQ RQGTPEASGH

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-ZEB1 antibody concentration is 1 mg/ml.

Description: ZEB1 is a zinc finger transcription factor that represses T-lymphocyte-specific IL2 gene expression by binding to a negative regulatory domain 100 nucleotides 5-prime of the IL2 transcription start site.ZEB1 encodes a zinc finger transcription factor that represses T-lymphocyte-specific IL2 gene (MIM 147680) expression by binding to a negative regulatory domain 100 nucleotides 5-prime of the IL2 transcription start site (Williams et al., 1991 [PubMed 1840704]).[supplied by OMIM].

Characteristics: Antigen Size: 1124 amino acids

Molecular Weight: 124kDa

Synonyms: BZP, ZEB, TCF8, AREB6, NIL2A, ZFHEP, NIL-2A, ZFHX1A, NIL-2-A, DELTA-EF1, MGC133261, MEB1, Nil2, Tcf8, Tcf18, Zfhep, Zfx1a, Zfhx1a, Zfx1ha, [delta]EF1, 3110032K11Rik, deltaEF1, zfhx1, kheper, ZFH/[d]EF1, bzp, zeb, tcf8, areb6, nil2a, zfhep, nil-2a, MGC82910, ZEB1, zfhx1a, nil-2-a, MGC97552, DKFZp469P2021

Application Details

Application Notes: WB Suggested Anti-ZEB1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-ZEB1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate

anti-Zinc Finger E-Box Binding Homeobox 1 (ZEB1) antibody (Image 2)

anti-Zinc Finger E-Box Binding Homeobox 1 (ZEB1) antibody (Image 3)

Publications

Product: Gregory, Bert, Paterson et al.: "The miR-200 family and miR-205 regulate epithelial to mesenchymal transition by targeting ZEB1 and SIP1." in: Nature cell biology, Vol. 10, Issue 5, pp. 593-601, 2008 (PubMed).