Ring Finger Protein 1 (RING1) antibody

Antigen: Ring Finger Protein 1 (RING1)

Synonyms: RNF1, RING1A

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Pig (Porcine)

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN487036

Additional Information

Alternative name: RING1 / RNF1

Gene ID: RING1

UniProt: Q06587

Immunogen: The immunogen for anti-RING1 antibody: synthetic peptide directed towards the middle region of human RING1

Sequence: APSPPEPGGEIELVFRPHPLLVEKGEYCQTRYVKTTGNAT VDHLSKYLAL

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Pig (Porcine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-RING1 antibody concentration is 1 mg/ml.

Description: RING1 belongs to the RING finger family, members of which characterized by a RING domain, a zinc-binding motif related to the zinc finger domain. The protein can bind DNA and can act as a transcriptional repressor. It is associated with the multimeric polycomb group protein complex. RING1 interacts with the polycomb group proteins BMI1, EDR1, and CBX4, and colocalizes with these proteins in large nuclear domains. It interacts with the CBX4 protein via its glycine-rich C-terminal domain. This gene maps to the HLA class II region, where it is contiguous with the RING finger genes FABGL and HKE4.This gene belongs to the RING finger family, members of which encode proteins characterized by a RING domain, a zinc-binding motif related to the zinc finger domain. The gene product can bind DNA and can act as a transcriptional repressor. It is associated with the multimeric polycomb group protein complex. The gene product interacts with the polycomb group proteins BMI1, EDR1, and CBX4, and colocalizes with these proteins in large nuclear domains. It interacts with the CBX4 protein via its glycine-rich C-terminal domain. The gene maps to the HLA class II region, where it is contiguous with the RING finger genes FABGL and HKE4. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Characteristics: Antigen Size: 406 amino acids

Molecular Weight: 42kDa

Application Details

Application Notes: WB Suggested Anti-RING1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Transfected 293T.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-RING1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Transfected 293T

Publications

Product: van Leenders, Dukers, Hessels et al.: "Polycomb-group oncogenes EZH2, BMI1, and RING1 are overexpressed in prostate cancer with adverse pathologic and clinical features." in: European urology, Vol. 52, Issue 2, pp. 455-63, 2007 (PubMed).