Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Ring Finger Protein 1 (RING1) antibody

Antigen

Ring Finger Protein 1 (RING1)

Synonyms RNF1, RING1A
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Pig (Porcine)

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN487036
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name RING1 / RNF1
Gene ID RING1
UniProt Q06587
Immunogen The immunogen for anti-RING1 antibody: synthetic peptide directed towards the middle region of human RING1
Sequence APSPPEPGGEIELVFRPHPLLVEKGEYCQTRYVKTTGNAT VDHLSKYLAL
Cross-Reactivity Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Pig (Porcine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-RING1 antibody concentration is 1 mg/ml.
Description RING1 belongs to the RING finger family, members of which characterized by a RING domain, a zinc-binding motif related to the zinc finger domain. The protein can bind DNA and can act as a transcriptional repressor. It is associated with the multimeric polycomb group protein complex. RING1 interacts with the polycomb group proteins BMI1, EDR1, and CBX4, and colocalizes with these proteins in large nuclear domains. It interacts with the CBX4 protein via its glycine-rich C-terminal domain. This gene maps to the HLA class II region, where it is contiguous with the RING finger genes FABGL and HKE4.This gene belongs to the RING finger family, members of which encode proteins characterized by a RING domain, a zinc-binding motif related to the zinc finger domain. The gene product can bind DNA and can act as a transcriptional repressor. It is associated with the multimeric polycomb group protein complex. The gene product interacts with the polycomb group proteins BMI1, EDR1, and CBX4, and colocalizes with these proteins in large nuclear domains. It interacts with the CBX4 protein via its glycine-rich C-terminal domain. The gene maps to the HLA class II region, where it is contiguous with the RING finger genes FABGL and HKE4. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Characteristics Antigen Size: 406 amino acids
Molecular Weight 42kDa

Application Details

Application Notes WB Suggested Anti-RING1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Transfected 293T.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product van Leenders, Dukers, Hessels et al.: "Polycomb-group oncogenes EZH2, BMI1, and RING1 are overexpressed in prostate cancer with adverse pathologic and clinical features." in: European urology, Vol. 52, Issue 2, pp. 455-63, 2007 (PubMed).

Alternatives

Alternatives for antigen "Ring Finger Protein 1 (RING1)", type "Antibodies"
Hosts Rabbit (41), Mouse (6)
Reactivities Human (46), Mouse (Murine) (25), Rat (Rattus) (25), Dog (Canine) (21), Cow (Bovine) (19), Pig (Porcine) (19), Chicken (18), Sheep (Ovine) (18)
Applications Western Blotting (WB) (30), ELISA (20), Immunofluorescence (IF) (15), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (7), Immunohistochemistry (IHC) (6), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Dot Blot (DB) (1), Immunocytochemistry (ICC) (1), Immunoelectron Microscopy (IEM) (1), Immunoprecipitation (IP) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1)
Epitopes N-Term (4), Internal Region (3), C-Term (2)