Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN487038

DMRT-Like Family A1 (DMRTA1) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms DMO, DMRT4, Dmrt4, dmrt4, XDmrt4, MGC83057, DMRTA1, dmo, dmrt99b, MGC147607
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN487038
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-DMRTA1 antibody: synthetic peptide directed towards the middle region of human DMRTA1
Sequence AENPQSTGGPAAGAALGLGALRQASGSATPAFEVFQQDYP EEKQEQKESK
Predicted Reactivity Horse : 92%, Bovine : 84%, Rabbit : 78%
Characteristics This is a rabbit polyclonal antibody against DMRTA1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name DMRTA1
Background DMRTA1 may be involved in sexual development.
Molecular Weight 53kDa
Gene ID 63951
NCBI Accession NP_071443, NM_022160
UniProt Q5VZB9
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-DMRTA1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Humphray, Oliver, Hunt et al.: "DNA sequence and analysis of human chromosome 9." in: Nature, Vol. 429, Issue 6990, pp. 369-74, 2004 (PubMed).

Alternatives for antigen "DMRT-Like Family A1 (DMRTA1)", type "Antibodies"
Hosts (19), (1)
Reactivities (18), (18), (13), (12)
Applications (11), (10), (5), (3)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (4), (2), (2), (2), (1), (1)
Beacon