Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Ring Finger Protein 41 (RNF41) antibody

Antigen

Ring Finger Protein 41 (RNF41)

Synonyms NRDP1, SBBI03, MGC45228
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Zebrafish, Xenopus laevis

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN487133
Quantity 50 µg
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name RNF41
Gene ID RNF41
UniProt A6NFW0
Immunogen The immunogen for anti-RNF41 antibody: synthetic peptide directed towards the middle region of human RNF41
Sequence QQTRIAELEKTSAEHKHQLAEQKRDIQLLKAYMRAIRSVN PNLQNLEETI
Cross-Reactivity Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-RNF41 antibody concentration is 1 mg/ml.
Description RNF41 contains a RING finger, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions. The specific function of this protein has not yet been determined. The protein encoded by this gene contains a RING finger, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions. The specific function of this protein has not yet been determined. Three alternatively spliced transcript variants encoding two distinct isoforms have been reported.
Characteristics Antigen Size: 246 amino acids
Molecular Weight 28kDa

Application Details

Application Notes WB Suggested Anti-RNF41 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Liver.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Proteolysis / Ubiquitin
Restrictions For Research Use only

Publications

Product Cao, Wu, Yen et al.: "Neuregulin-induced ErbB3 downregulation is mediated by a protein stability cascade involving the E3 ubiquitin ligase Nrdp1." in: Molecular and cellular biology, Vol. 27, Issue 6, pp. 2180-8, 2007 (PubMed).

Alternatives

Alternatives for antigen "Ring Finger Protein 41 (RNF41)", type "Antibodies"
Hosts Rabbit (22), Mouse (1)
Reactivities Human (23)
Applications Immunofluorescence (IF) (15), Western Blotting (WB) (8), ELISA (6), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Immunoprecipitation (IP) (2), Immunoelectron Microscopy (IEM) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1)
Epitopes AA 250-300 (1), C-Term (1), C-Term,AA 254-281 (1), Internal Region (1)