Homeobox D1 (HOXD1) (C-Term) antibody

Details for Product No. ABIN487160
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms HOX4, HOX4G, Hox-4.7, Hox-4.9, Xhox.lab, Xhox.lab1, Xlab, Xlab-1, xhoxd1, hox4, xlab, hox4g, hox-4.7, MGC131028, xhox.lab1, HOXA1
Epitope
C-Term
(4), (3), (3), (2), (2), (2), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Fruit Fly (Drosophila melanogaster), Xenopus laevis, Dog (Canine), Human
(18), (4), (1), (1), (1)
Host
Rabbit
(14), (5)
Clonality
Polyclonal
Application
Western Blotting (WB)
(19), (5), (4), (4)
Pubmed 1 reference available
Catalog no. ABIN487160
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human HOXD1
Sequence LTRARRIEIANCLHLNDTQVKIWFQNRRMKQKKREREGLL ATAIPVAPLQ
Predicted Reactivity Bovine : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Rabbit : 100 %, Rat : 100 %
Characteristics This is a rabbit polyclonal antibody against HOXD1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name HOXD1
Background HOXD1 is a protein with a homeobox DNA-binding domain, and it belongs to the Antp homeobox family. This nuclear protein functions as a sequence-specific transcription factor that is involved in differentiation and limb development. Mutations in this gene have been associated with severe developmental defects on the anterior-posterior (a-p) limb axis.This gene is a member of the Antp homeobox family and encodes a protein with a homeobox DNA-binding domain. This nuclear protein functions as a sequence-specific transcription factor that is involved in differentiation and limb development. Mutations in this gene have been associated with severe developmental defects on the anterior-posterior (a-p) limb axis.
Molecular Weight 34 kDa
Gene ID 3231
NCBI Accession NM_024501, NP_078777
UniProt Q9GZZ0
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 328 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Homeobox D1 (HOXD1) (C-Term) antibody WB Suggested Anti-HOXD1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: MCF7 cell lysate
Background publications Kosaki, Kosaki, Suzuki et al.: "Complete mutation analysis panel of the 39 human HOX genes." in: Teratology, Vol. 65, Issue 2, pp. 50-62, 2002 (PubMed).

Hosts (14), (5)
Reactivities (18), (4), (1), (1), (1)
Applications (19), (5), (4), (4)
Epitopes (4), (3), (3), (2), (2), (2), (1), (1), (1)
back to top