Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN487245

Chromosome 10 Open Reading Frame 92 (C1ORF92) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C1orf92, RP11-356J7.1, 4933430H15Rik
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN487245
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-C1orf92 antibody: synthetic peptide directed towards the middle region of human C1orf92
Sequence VDKTDKTQTMKTPKGLGKKKEKSWELAKKEEKLGSGQSPT QGTPKKEDAT
Characteristics This is a rabbit polyclonal antibody against C1orf92. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name C1orf92
Background The function of this protein remains unknown.
Molecular Weight 39kDa
Gene ID 149499
NCBI Accession NP_653303, NM_144702
UniProt Q8N4P6
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-C1orf92 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Strausberg, Feingold, Grouse et al.: "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 99, Issue 26, pp. 16899-903, 2002 (PubMed).

Alternatives for antigen "Chromosome 10 Open Reading Frame 92 (C1ORF92)", type "Antibodies"
Hosts (3)
Reactivities (2)
Applications (3), (2)
Epitopes (1), (1)
Beacon