Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN487257

GID Complex Subunit 4, VID24 Homolog (S. Cerevisiae) (GID4) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C17orf39, VID24, 4933439F18Rik
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN487257
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-C17orf39 antibody: synthetic peptide directed towards the C terminal of human C17orf39
Sequence SFAGFYYICFQKSAASIEGYYYHRSSEWYQSLNLTHVPEH SAPIYEFR
Predicted Reactivity Chicken : 100%, Dog : 100%, Horse : 100%, Human : 100%, Rabbit : 100%
Characteristics This is a rabbit polyclonal antibody against C17orf39. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name C17orf39
Background The exact function of C17orf39 remains unknown. The multiprotein Mediator complex is a coactivator required for activation of RNA polymerase II transcription by DNA bound transcription factors. The protein encoded by this gene is thought to be a subunit of the Mediator complex. This gene is located within the Smith-Magenis syndrome region on chromosome 17.
Molecular Weight 33kDa
Gene ID 79018
NCBI Accession NP_076957, NM_024052
UniProt Q8IVV7
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-C17orf39 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Bi, Yan, Stankiewicz et al.: "Genes in a refined Smith-Magenis syndrome critical deletion interval on chromosome 17p11.2 and the syntenic region of the mouse." in: Genome research, Vol. 12, Issue 5, pp. 713-28, 2002 (PubMed).

Alternatives for antigen "GID Complex Subunit 4, VID24 Homolog (S. Cerevisiae) (GID4)", type "Antibodies"
Hosts (17)
Reactivities (15), (13), (13), (13)
Applications (10), (8), (5), (3)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (3)
Beacon