SCTR antibody (C-Term)

Catalog No. ABIN4886718

Product Details anti-SCTR Antibody

Target: SCTR (Secretin Receptor (SCTR))

Binding Specificity: AA 398-440, C-Term

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SCTR antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for Secretin receptor(SCTR) detection. Tested with WB in Human,Rat.

Sequence: EVQKKWQQWH LREFPLHPVA SFSNSTKASH LEQSQGTCRT SII

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Secretin receptor(SCTR) detection. Tested with WB in Human,Rat.
Gene Name: secretin receptor
Protein Name: Secretin receptor

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human SCTR (398-440aa EVQKKWQQWHLREFPLHPVASFSNSTKASHLEQSQGTCRTSII).

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for SCTR

Target: SCTR (Secretin Receptor (SCTR))

Alternative Name: SCTR (SCTR Products)

Synonyms: SR antibody, 6530402O03Rik antibody, SEC-R antibody, secretin receptor antibody, SCTR antibody, Sctr antibody

Background: Human secretin receptor (gene name SCTR) is a G protein-coupled receptor and belongs to the glucagon-VIP-secretin receptor family. It binds secretin which is the most potent regulator of pancreatic bicarbonate, electrolyte and volume secretion. Secretin and its receptor are suggested to be involved in pancreatic cancer and autism. The SCTR gene is mapped to chromosome 2q14.1 by fluorescence in situ hybridization.

Synonyms: SCT-R | SCTR | Secretin receptor | SR | P47872

Gene ID: 6344

UniProt: P47872