TLN2 antibody (Middle Region)

Catalog No. ABIN4886745

Product Details anti-TLN2 Antibody

Target: TLN2 (Talin 2 (TLN2))

Binding Specificity: AA 1787-1822, Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TLN2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for Talin-2(TLN2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequence: NPKAQHTHDA ITEAAQLMKE AVDDIMVTLN EAASEV

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Talin-2(TLN2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: talin 2
Protein Name: Talin-2

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human Talin 2 (1787-1822aa NPKAQHTHDAITEAAQLMKEAVDDIMVTLNEAASEV).

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

References for anti-TLN2 antibody (ABIN4886745)

Li, Li, Qi, Rychahou, Jafari, Huang: "The role of talin2 in breast cancer tumorigenesis and metastasis." in: Oncotarget, Vol. 8, Issue 63, pp. 106876-106887, (2017) (PubMed).

Target Details for TLN2

Target: TLN2 (Talin 2 (TLN2))

Alternative Name: TLN2 (TLN2 Products)

Synonyms: TLN2 antibody, ilweq antibody, talin-2 antibody, ILWEQ antibody, 5730421P04Rik antibody, AI507121 antibody, AI787438 antibody, AL118320 antibody, mKIAA0320 antibody, RGD1565416 antibody, talin 2 antibody, talin 2 S homeolog antibody, TLN2 antibody, tln2.S antibody, tln2 antibody, Tln2 antibody

Background: Talin 2 is a protein in humans that is encoded by the TLN2 gene. It belongs to the talin protein family. This gene encodes a protein related to talin 1, a cytoskeletal protein that plays a significant role in the assembly of actin filaments and in spreading and migration of various cell types, including fibroblasts and osteoclasts. Talin-2 is expressed at high levels in cardiac muscle and functions to provide linkages between the extracellular matrix and actin cytoskeleton at costamere structures to transduce force laterally.

Synonyms: Talin2 | Talin 2 | Talin-2 | TLN2 | TLN 2 | TLN-2 | ILWEQ | Q9Y4G6

Gene ID: 83660

UniProt: Q9Y4G6

Pathways: Cell-Cell Junction Organization, Maintenance of Protein Location