Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Histone Deacetylase 8 (HDAC8) antibody

Antigen

Histone Deacetylase 8 (HDAC8)

Synonyms RPD3, HDACL1, 2610007D20Rik, RGD1562895, zgc:66196, wu:fd19a02, MGC80565, hdac8, HDAC8, MGC142318, ATHDA8, HDA08, HDA8, histone deacetylase 8, HISTONE DEACETYLASE 8, T27G7.14, T27G7_14
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine)

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN501306
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name HDAC8
Gene ID HDAC8
UniProt Q9BY41
Immunogen The immunogen for anti-HDAC8 antibody: synthetic peptide directed towards the N terminal of human HDAC8
Sequence MEEPEEPADSGQSLVPVYIYSPEYVSMCDSLAKIPKRASM VHSLIEAYAL
Cross-Reactivity Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-HDAC8 antibody concentration is 1 mg/ml.
Description Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene belongs to class I of the histone deacetylase/acuc/apha family. It has histone deacetylase activity and represses transcription when tethered to a promoter. Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene belongs to class I of the histone deacetylase/acuc/apha family. It has histone deacetylase activity and represses transcription when tethered to a promoter. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Characteristics Antigen Size: 377 amino acids
Molecular Weight 42kDa

Application Details

Application Notes WB Suggested Anti-HDAC8 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Transfected 293T.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Cardiovascular, Hypertrophy, Transcription Factors, DNA/RNA, Wnt Signaling
Restrictions For Research Use only

Publications

Product Balasubramanian, Ramos, Luo et al.: "A novel histone deacetylase 8 (HDAC8)-specific inhibitor PCI-34051 induces apoptosis in T-cell lymphomas." in: Leukemia : official journal of the Leukemia Society of America, Leukemia Research Fund, U.K, Vol. 22, Issue 5, pp. 1026-34, 2008 (PubMed).

Alternatives

Alternatives for antigen "Histone Deacetylase 8 (HDAC8)", type "Antibodies"
Hosts Rabbit (64), Mouse (3)
Reactivities Human (65), Mouse (Murine) (46), Rat (Rattus) (42), Cow (Bovine) (21), Chicken (19), Horse (Equine) (18), Pig (Porcine) (18), Cat (Feline) (1), Dog (Canine) (1), Xenopus laevis (1), Zebrafish (1)
Applications Western Blotting (WB) (39), ELISA (23), Immunofluorescence (IF) (23), Immunohistochemistry (IHC) (21), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (10), Immunoprecipitation (IP) (9), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Dot Blot (DB) (1), Immunoelectron Microscopy (IEM) (1)
Conjugates Alexa Fluor 350 (2), Alexa Fluor 488 (2), Alexa Fluor 555 (2), Alexa Fluor 647 (2), PE,Cy5.5 (2), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy7 (1)
Epitopes pSer39 (12), N-Term (4), C-Term (3), AA 305-377 (1), pTyr594 (1)