Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN501347

Kelch-Like 25 (Drosophila) (KLHL25) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ENC-2, ENC2, 2810402K13Rik, BC027373, Enc-1, RGD1310815, Xencr-2, encr-2, klhl25, MGC147232
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN501347
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-KLHL25 antibody: synthetic peptide directed towards the N terminal of human KLHL25
Sequence LFPSNCLGMMLLSDAHQCRRLYEFSWRMCLVHFETVRQSE DFNSLSKDTL
Predicted Reactivity Dog : 100%, Human : 100%, Bovine : 85%, Chicken : 78%
Characteristics This is a rabbit polyclonal antibody against KLHL25. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name KLHL25
Background KLHL25 is also known as ENC2. It is a BTB/POZ KELCH domain protein
Molecular Weight 66kDa
Gene ID 64410
NCBI Accession NP_071925, NM_022480
UniProt Q9H0H3
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-KLHL25 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Mehrle, Rosenfelder, Schupp et al.: "The LIFEdb database in 2006." in: Nucleic acids research, Vol. 34, Issue Database issue, pp. D415-8, 2005 (PubMed).

Alternatives for antigen "Kelch-Like 25 (Drosophila) (KLHL25)", type "Antibodies"
Hosts (11), (9), (9)
Reactivities (29), (2), (2), (2), (1), (1)
Applications (28), (18), (5), (3), (2), (1)
Epitopes (9), (4), (2), (2), (2), (1), (1)
Beacon