Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN501431

BTB (POZ) Domain-Containing Protein KCTD4 (KCTD4) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms AU017169, 2210017A09Rik, bA321C24.3, wu:fk37b10, zgc:92463
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Zebrafish (Danio rerio), Dog (Canine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 2 references available
Catalog no. ABIN501431
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-KCTD4 antibody: synthetic peptide directed towards the middle region of human KCTD4
Sequence EITDNHDRSQGLRIFCNAPDFISKIKSRIVLVSKSRLDGF PEEFSISSNI
Predicted Reactivity Bovine : 100%, Dog : 100%, Human : 100%, Zebrafish : 100%, Chicken : 92%, Mouse : 92%, Rat : 92%
Characteristics This is a rabbit polyclonal antibody against KCTD4. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name KCTD4
Background KCTD4 contains 1 BTB (POZ) domain. The exact function of KCTD4 remains unknown.
Molecular Weight 30kDa
Gene ID 386618
NCBI Accession NP_940686, NM_198404
UniProt Q8WVF5
Research Area Signaling, Metabolism, Transporters
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-KCTD4 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Lazrek, Goffard, Schanen et al.: "Detection of hepatitis C virus antibodies and RNA among medicolegal autopsy cases in Northern France." in: Diagnostic microbiology and infectious disease, Vol. 55, Issue 1, pp. 55-8, 2006 (PubMed).

Background publications Kimura, Wakamatsu, Suzuki et al.: "Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes." in: Genome research, Vol. 16, Issue 1, pp. 55-65, 2006 (PubMed).

Alternatives for antigen "BTB (POZ) Domain-Containing Protein KCTD4 (KCTD4)", type "Antibodies"
Hosts (12), (5)
Reactivities (14), (4), (1), (1), (1), (1)
Applications (17), (4), (4), (2), (1)
Epitopes (5), (2), (2), (1)
Beacon