Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN501445

Zinc Finger Protein 165 (ZNF165) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CT53, LD65, ZSCAN7, ZSCAN16, MGC140342
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN501445
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZNF165 antibody: synthetic peptide directed towards the middle region of human ZNF165
Sequence THQKSCKHGTCDQSFKWNSDFINHQIIYAGEKNHQYGKSF KSPKLAKHAA
Predicted Reactivity Human : 100%, Pig : 84%
Characteristics This is a rabbit polyclonal antibody against ZNF165. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ZNF165
Background This protein is a member of the Kruppel family of zinc finger proteins. Members of this DNA-binding protein family act as transcriptional regulators. The protein may play a role in spermatogenesis. This gene encodes a member of the Kruppel family of zinc finger proteins. Members of this DNA-binding protein family act as transcriptional regulators. This gene is located within a cluster of zinc finger family members. The encoded protein may play a role in spermatogenesis.
Molecular Weight 56kDa
Gene ID 7718
NCBI Accession NP_003438, NM_003447
UniProt P49910
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZNF165 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Mungall, Palmer, Sims et al.: "The DNA sequence and analysis of human chromosome 6." in: Nature, Vol. 425, Issue 6960, pp. 805-11, 2003 (PubMed).

Alternatives for antigen "Zinc Finger Protein 165 (ZNF165)", type "Antibodies"
Hosts (11), (5)
Reactivities (16)
Applications (16), (5), (2), (2), (2), (2), (2)
Epitopes (4), (3), (2), (2), (1), (1), (1), (1)
Beacon