TAR DNA Binding Protein (TARDBP) antibody

Antigen: TAR DNA Binding Protein (TARDBP)

Synonyms: ALS10, TDP-43, Tdp43, C85084, 1190002A23Rik, fb77f02, fc52g10, wu:fb77f02, wu:fc52g10, tardbp, MGC53141, TARDBP, TDP43, DKFZp459I2127, MGC129120

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Chicken, Dog (Canine), Xenopus laevis, Zebrafish

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN501463

Additional Information

Alternative name: TARDBP

Gene ID: TARDBP

UniProt: Q13148

Immunogen: The immunogen for anti-TARDBP antibody: synthetic peptide directed towards the N terminal of human TARDBP

Sequence: VYVVNYPKDNKRKMDETDASSAVKVKRAVQKTSDLIVLGL PWKTTEQDLK

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-TARDBP antibody concentration is 1 mg/ml.

Description: HIV-1, the causative agent of acquired immunodeficiency syndrome (AIDS), contains an RNA genome that produces a chromosomally integrated DNA during the replicative cycle. Activation of HIV-1 gene expression by the transactivator Tat is dependent on an RNA regulatory element (TAR) located downstream of the transcription initiation site. TARDBP is a transcriptional repressor that binds to chromosomally integrated TAR DNA and represses HIV-1 transcription.HIV-1, the causative agent of acquired immunodeficiency syndrome (AIDS), contains an RNA genome that produces a chromosomally integrated DNA during the replicative cycle. Activation of HIV-1 gene expression by the transactivator Tat is dependent on an RNA regulatory element (TAR) located downstream of the transcription initiation site. The protein encoded by this gene is a transcriptional repressor that binds to chromosomally integrated TAR DNA and represses HIV-1 transcription. In addition, this protein regulates alternate splicing of the CFTR gene. A similar pseudogene is present on chromosome 20. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Characteristics: Antigen Size: 414 amino acids

Molecular Weight: 45kDa

Application Details

Application Notes: WB Suggested Anti-TARDBP Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Liver.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, Transcription Factors, DNA/RNA, Hormones, Cytokines

Restrictions: For Research Use only

Images

WB Suggested Anti-TARDBP Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Liver

Publications

Product: Kabashi, Valdmanis, Dion et al.: "TARDBP mutations in individuals with sporadic and familial amyotrophic lateral sclerosis." in: Nature genetics, Vol. 40, Issue 5, pp. 572-4, 2008 (PubMed).