Forkhead Box B1 (FOXB1) (C-Term) antibody

Details for Product No. ABIN501465
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms FKH5, HFKH-5, C43, Fkh5, Foxb1a, Foxb1b, Hfh-e5.1, Mf3, Twh, fkh-5, fkh5, xfkh-5, FOXB1, hfkh-5, foxB1, foxB
Epitope
C-Term
(5), (2), (1), (1), (1)
Reactivity
Mouse (Murine), Cow (Bovine), Xenopus laevis, Human
(23), (16), (15), (15), (12), (3), (2), (2), (1)
Host
Rabbit
(20), (6)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(11), (10), (9), (4), (3), (3)
Pubmed 2 references available
Catalog no. ABIN501465
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human FOXB1
Sequence PSCGDMFENGSFLRRRKRFKVLKSDHLAPSKPADAAQYLQ QQAKLRLSAL
Predicted Reactivity Bovine : 93 %, Guinea pig : 93 %, Human : 93 %, Mouse : 93 %, African clawed frog : 83 %
Characteristics This is a rabbit polyclonal antibody against FOXB1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name FOXB1
Background FOXB1 is a winged helix/forkhead transcription factor. FOXB1 is specifically expressed in the developing central nervous system (CNS). Early embryonic FOXB1 expression is restricted to the mammiliary body region of the caudal hypothalamus, midbrain, hindbrain and spinal cord. FOXB1 may play a role in postnatal growth, lactation and CNS development.
Molecular Weight 35 kDa
Gene ID 27023
NCBI Accession NM_012182, NP_036314
UniProt Q99853
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 325 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Product cited in: Lazrek, Goffard, Schanen et al.: "Detection of hepatitis C virus antibodies and RNA among medicolegal autopsy cases in Northern France." in: Diagnostic microbiology and infectious disease, Vol. 55, Issue 1, pp. 55-8, 2006 (PubMed).

Background publications Talmud, Drenos, Shah et al.: "Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes." in: Genome research, Vol. 16, Issue 1, pp. 55-65, 2006 (PubMed).

Hosts (20), (6)
Reactivities (23), (16), (15), (15), (12), (3), (2), (2), (1)
Applications (11), (10), (9), (4), (3), (3)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (5), (2), (1), (1), (1)
back to top