Zinc Finger Protein 488 (ZNF488) (Middle Region) antibody

Details for Product No. ABIN501523
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Gm1206, Znf488
Epitope
Middle Region
(7), (6), (3), (2), (1), (1), (1)
Reactivity
Human
(22), (8), (6), (2), (1), (1)
Host
Rabbit
(22)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(22), (8)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN501523
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human ZNF488
Sequence MKDRQVDAQAQEREHDDPTGQPGAPQLTQNIPRGPAGSKV FSVWPSGARS
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against ZNF488. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZNF488
Background ZNF488 is a candidate transcription factor.
Molecular Weight 37 kDa
Gene ID 118738
NCBI Accession NM_153034, NP_694579
UniProt Q96MN9
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 340 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Zinc Finger Protein 488 (ZNF488) (Middle Region) antibody WB Suggested Anti-ZNF488 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Hela cell lysate
Background publications Lim, Hao, Shaw et al.: "A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration." in: Cell, Vol. 125, Issue 4, pp. 801-14, 2006 (PubMed).

Validation Images
Did you look for something else?
back to top