Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN501554

Zinc Finger, CCHC Domain Containing 17 (ZCCHC17) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms PS1D, pNO40, HSPC251, RP11-266K22.1, RGD1565267, LDC4, pS1D, 2810055E05Rik, ps1d, zgc:65790, zgc:85656, pno40, hspc251, DKFZp459G2227
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Dog (Canine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN501554
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZCCHC17 antibody: synthetic peptide directed towards the middle region of human ZCCHC17
Sequence CFMQPGGTKYSLIPDEEEEKEEAKSAEFEKPDPTRNPSRK RKKEKKKKKH
Predicted Reactivity Dog : 100%, Human : 100%, Bovine : 92%, Pig : 85%
Characteristics This is a rabbit polyclonal antibody against ZCCHC17. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ZCCHC17
Background ZCCHC17 contains 1 CCHC-type zinc finger and 1 S1 motif domain. The exact function of ZDHHC19 remains unknown.
Molecular Weight 27kDa
Gene ID 51538
NCBI Accession NP_057589, NM_016505
UniProt Q9NP64
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZCCHC17 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Gregory, Barlow, McLay et al.: "The DNA sequence and biological annotation of human chromosome 1." in: Nature, Vol. 441, Issue 7091, pp. 315-21, 2006 (PubMed).

Alternatives for antigen "Zinc Finger, CCHC Domain Containing 17 (ZCCHC17)", type "Antibodies"
Hosts (14)
Reactivities (12), (10), (1), (1), (1)
Applications (10), (8), (4), (3)
Epitopes (4), (3), (2), (1), (1)
Beacon