Did you know that you can buy products from over 140 different suppliers from us?

Zinc Finger, CCHC Domain Containing 17 (ZCCHC17) (Middle Region) antibody

Details for Product No. ABIN501554
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ps1d, zgc:65790, zgc:85656, pno40, hspc251, DKFZp459G2227, HSPC251, PS1D, RP11-266K22.1, pNO40, 2810055E05Rik, LDC4, pS1D, RGD1565267
Epitope
Middle Region
(8), (7), (2), (1), (1)
Reactivity
Dog (Canine), Cow (Bovine), Human
(16), (6), (1), (1), (1)
Host
Rabbit
(18)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(14), (12), (7), (4)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN501554
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human ZCCHC17
Sequence CFMQPGGTKYSLIPDEEEEKEEAKSAEFEKPDPTRNPSRK RKKEKKKKKH
Predicted Reactivity Dog : 100 %, Human : 100 %, Bovine : 90 %, Pig : 80 %
Characteristics This is a rabbit polyclonal antibody against ZCCHC17. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZCCHC17
Background ZCCHC17 contains 1 CCHC-type zinc finger and 1 S1 motif domain. The exact function of ZDHHC19 remains unknown.
Molecular Weight 27 kDa
Gene ID 51538
NCBI Accession NM_016505, NP_057589
UniProt Q9NP64
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 241 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Gregory, Barlow, McLay et al.: "The DNA sequence and biological annotation of human chromosome 1." in: Nature, Vol. 441, Issue 7091, pp. 315-21, 2006 (PubMed).

Validation Images
back to top