Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN501579

Minichromosome Maintenance Deficient 9 (MCM9) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 9030408O17Rik, Gm235, Mcmdc1, C6orf61, MCMDC1, dJ329L24.1, dJ329L24.3, MCM9
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN501579
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-MCM9 antibody: synthetic peptide directed towards the N terminal of human MCM9
Sequence NSDQVTLVGQVFESYVSEYHKNDILLILKERDEDAHYPVV VNAMTLFETN
Predicted Reactivity Bovine : 100%, Dog : 100%, Human : 100%, Mouse : 100%, Pig : 100%
Characteristics This is a rabbit polyclonal antibody against MCM9. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name MCM9
Background MCM9 is a protein that shares similarity with minichromosome maintenance (MCM) proteins, which are known to be essential for initiation of DNA replication.This gene encodes a protein that shares similarity with minichromosome maintenance (MCM) proteins, which are known to be essential for initiation of DNA replication.
Molecular Weight 44kDa
Gene ID 254394
NCBI Accession NP_694987, NM_153255
UniProt B3KV41
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-MCM9 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Maiorano, Lutzmann, Méchali: "MCM proteins and DNA replication." in: Current opinion in cell biology, Vol. 18, Issue 2, pp. 130-6, 2006 (PubMed).

Alternatives for antigen "Minichromosome Maintenance Deficient 9 (MCM9)", type "Antibodies"
Hosts (4)
Reactivities (3)
Applications (4)
Epitopes (2), (2), (1)
Beacon