Did you know that you can buy products from over 140 different suppliers from us?

Retinoic Acid Receptor, gamma (RARG) (N-Term) antibody

Details for Product No. ABIN501629
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms RARC, NR1B3, AI385767, Nr1b3, RARD, RARgamma2, nr1b3, RARG
Epitope
N-Term
(7), (3), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
(38), (19), (17), (13), (12), (12), (1)
Host
Rabbit
(28), (10)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(23), (10), (6), (4), (4), (3), (2), (2), (2), (2), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN501629
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human RARG
Sequence SPPFEMLSPSFRGLGQPDLPKEMASLSVETQSTSSEEMVP SSPSPPPPPR
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Guinea pig : 100 %, Human : 100 %, Mouse : 100 %, Rat : 100 %
Characteristics This is a rabbit polyclonal antibody against RARG. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name RARG
Background RARG is a receptor for retinoic acid. This metabolite has profound effects on vertebrate development. Retinoic acid is a morphogen and is a powerful teratogen. RARG controls cell function by directly regulating gene expression.
Molecular Weight 50 kDa
Gene ID 5916
NCBI Accession NM_000966, NP_000957
UniProt P13631
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 454 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Dey, De, Wang et al.: "CSK controls retinoic acid receptor (RAR) signaling: a RAR-c-SRC signaling axis is required for neuritogenic differentiation." in: Molecular and cellular biology, Vol. 27, Issue 11, pp. 4179-97, 2007 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN501629
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top