Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN501629

Retinoic Acid Receptor, gamma (RARG) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms RARC, NR1B3, AI385767, Nr1b3, RARD, RARgamma2, nr1b3, RARG
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN501629
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-RARG antibody: synthetic peptide directed towards the N terminal of human RARG
Sequence SPPFEMLSPSFRGLGQPDLPKEMASLSVETQSTSSEEMVP SSPSPPPPPR
Predicted Reactivity Bovine : 100%, Dog : 100%, Guinea pig : 100%, Human : 100%, Mouse : 100%, Rat : 100%
Characteristics This is a rabbit polyclonal antibody against RARG. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name RARG
Background RARG is a receptor for retinoic acid. This metabolite has profound effects on vertebrate development. Retinoic acid is a morphogen and is a powerful teratogen. RARG controls cell function by directly regulating gene expression.
Molecular Weight 50kDa
Gene ID 5916
NCBI Accession NP_000957, NM_000966
UniProt P13631
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-RARG antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Dey, De, Wang et al.: "CSK controls retinoic acid receptor (RAR) signaling: a RAR-c-SRC signaling axis is required for neuritogenic differentiation." in: Molecular and cellular biology, Vol. 27, Issue 11, pp. 4179-97, 2007 (PubMed).

Alternatives for antigen "Retinoic Acid Receptor, gamma (RARG)", type "Antibodies"
Hosts (27), (11)
Reactivities (38), (18), (17), (13), (12), (12), (1)
Applications (23), (10), (7), (4), (3), (2), (2), (2), (2), (1), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (7), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Beacon