Helicase-Like Transcription Factor (HLTF) antibody

Antigen: Helicase-Like Transcription Factor (HLTF)

Synonyms: Snf2l3, Smarca3, smarca3, wu:fc33f07, HLTF, SMARCA3, MGC131155, RUSH, ZBU1, HLTF1, RNF80, HIP116, SNF2L3, HIP116A, P113, AF010600, BC057116

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Dog (Canine), Rabbit

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN501652

Additional Information

Alternative name: SMARCA3 / HLTF

Gene ID: HLTF

UniProt: Q14527

Immunogen: The immunogen for anti-HLTF antibody: synthetic peptide directed towards the N terminal of human HLTF

Sequence: SWMFKRDPVWKYLQTVQYGVHGNFPRLSYPTFFPRFEFQD VIPPDDFLTS

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rabbit

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-HLTF antibody concentration is 1 mg/ml.

Description: SMARCA3 (HLTF) is a member of the SWI/SNF family. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. SMARCA3 contains a RING finger DNA binding motif. Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.This gene encodes a member of the SWI/SNF family. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein contains a RING finger DNA binding motif. Two transcript variants encoding the same protein have been found for this gene. However, use of an alternative translation start site produces an isoform that is truncated at the N-terminus compared to the full-length protein.

Characteristics: Antigen Size: 1009 amino acids

Molecular Weight: 114kDa

Application Details

Application Notes: WB Suggested Anti-HLTF Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Hela cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-HLTF Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Hela cell lysate

Publications

Product: Unk, Hajdú, Fátyol et al.: "Human HLTF functions as a ubiquitin ligase for proliferating cell nuclear antigen polyubiquitination." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 105, Issue 10, pp. 3768-73, 2008 (PubMed).