E2F Transcription Factor 2 (E2F2) antibody

Antigen: E2F Transcription Factor 2 (E2F2)

Synonyms: E2F-2, E2F, E2F2, dE2F-2, dE2F2, DmelCG1071, CG1071

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Xenopus laevis

Conjugate: Un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Catalog no.: ABIN501674

Additional Information

Alternative name: E2F2

Gene ID: E2F2

UniProt: Q14209

Immunogen: The immunogen for anti-E2F2 antibody: synthetic peptide directed towards the middle region of human E2F2

Sequence: DQFLSPTLACSSPLISFSPSLDQDDYLWGLEAGEGISDLF DSYDLGDLLI

Cross-Reactivity: Cow (Bovine), Human, Mouse (Murine)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-E2F2 antibody concentration is 1 mg/ml.

Description: E2F2 is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein and another 2 members, E2F1 and E2F3, have an additional cyclin binding domain. This protein binds specifically to retinoblastoma protein pRB in a cell-cycle dependent manner, and it exhibits overall 46% amino acid identity to E2F1.The protein encoded by this gene is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein and another 2 members, E2F1 and E2F3, have an additional cyclin binding domain. This protein binds specifically to retinoblastoma protein pRB in a cell-cycle dependent manner, and it exhibits overall 46% amino acid identity to E2F1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Characteristics: Antigen Size: 437 amino acids

Molecular Weight: 47kDa

Application Details

Application Notes: WB Suggested Anti-E2F2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human brain.
Immunohistochemistry with Brain, cerebellum tissue at an antibody concentration of 5µg/ml using anti-E2F2 antibody (ABIN501674).

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, Transcription Factors

Restrictions: For Research Use only

Images

WB Suggested Anti-E2F2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human brain

Immunohistochemistry with Brain, cerebellum tissue at an antibody concentration of 5µg/ml using anti-E2F2 antibody (ARP38418_P050)

Publications

Product: Raj, Liu, Samadashwily et al.: "Survivin repression by p53, Rb and E2F2 in normal human melanocytes." in: Carcinogenesis, Vol. 29, Issue 1, pp. 194-201, 2008 (PubMed).