Myocyte Enhancer Factor 2A (MEF2A) antibody

Antigen: Myocyte Enhancer Factor 2A (MEF2A)

Synonyms: ADCAD1, RSRFC4, RSRFC9, A430079H05Rik, wu:fd19d02, MEF2A, DKFZp469F0316, mef2a, MGC52609, xmef2a

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Zebrafish, Dog (Canine), Chicken, Xenopus laevis, Pig (Porcine)

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN501715

Additional Information

Alternative name: MEF2A

Gene ID: MEF2A

UniProt: Q02078

Immunogen: The immunogen for anti-MEF2A antibody: synthetic peptide directed towards the N terminal of human MEF2A

Sequence: GRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDC EIALIIFNSS

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Pig (Porcine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-MEF2A antibody concentration is 1 mg/ml.

Description: The MEF2 genes are members of the MADS gene family (named for the yeast mating type-specific transcription factor MCM1, the plant homeotic genes 'agamous' and 'deficiens' and the human serum response factor SRF (MIM 600589)),a family that also includes several homeotic genes and other transcription factors, all of which share a conserved DNA-binding domain. The process of differentiation from mesodermal precursor cells to myoblasts has led to the discovery of a variety of tissue-specific factors that regulate muscle gene expression. The myogenic basic helix-loop-helix proteins, including myoD (MIM159970), myogenin (MIM 159980), MYF5 (MIM 159990), and MRF4 (MIM159991) are one class of identified factors. A second family of DNA binding regulatory proteins is the myocyte-specific enhancer factor-2 (MEF2) family. Each of these proteins binds to the MEF2 target DNA sequence present in the regulatory regions of many, if not all, muscle-specific genes. The MEF2 genes are members of the MADS gene family (named for the yeast mating type-specific transcription factor MCM1, the plant homeotic genes 'agamous' and 'deficiens' and the human serum response factor SRF (MIM 600589)),a family that also includes several homeotic genes and other transcription factors, all of which share a conserved DNA-binding domain.The process of differentiation from mesodermal precursor cells to myoblasts has led to the discovery of a variety of tissue-specific factors that regulate muscle gene expression. The myogenic basic helix-loop-helix proteins, including myoD (MIM 159970), myogenin (MIM 159980), MYF5 (MIM 159990), and MRF4 (MIM 159991) are one class of identified factors. A second family of DNA binding regulatory proteins is the myocyte-specific enhancer factor-2 (MEF2) family. Each of these proteins binds to the MEF2 target DNA sequence present in the regulatory regions of many, if not all, muscle-specific genes. The MEF2 genes are members of the MADS gene family (named for the yeast mating type-specific transcription factor MCM1, the plant homeotic genes 'agamous' and 'deficiens' and the human serum response factor SRF (MIM 600589)), a family that also includes several homeotic genes and other transcription factors, all of which share a conserved DNA-binding domain.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Characteristics: Antigen Size: 507 amino acids

Molecular Weight: 55kDa

Application Details

Application Notes: WB Suggested Anti-MEF2A Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Small Intestine.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Cardiovascular, Hypertrophy, Cardiogenesis, Transcription Factors, Neurogenesis

Restrictions: For Research Use only

Images

WB Suggested Anti-MEF2A Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Small Intestine

Publications

Product: Ramachandran, Yu, Gulick: "Nuclear respiratory factor 1 controls myocyte enhancer factor 2A transcription to provide a mechanism for coordinate expression of respiratory chain subunits." in: The Journal of biological chemistry, Vol. 283, Issue 18, pp. 11935-46, 2008 (PubMed).