Did you know that you can buy products from over 140 different suppliers from us?

Myocyte Enhancer Factor 2B (MEF2B) (N-Term) antibody

Details for Product No. ABIN501723
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms RSRFR2, AI451606, si:ch211-125m10.1
Epitope
N-Term
(11), (7), (3), (3), (2), (2), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Zebrafish (Danio rerio), Fruit Fly (Drosophila melanogaster), Human
(54), (22), (13), (12), (12)
Host
Rabbit
(30), (27)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(38), (37), (11), (10), (3), (2), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN501723
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human MEF2B
Sequence MGRKKIQISRILDQRNRQVTFTKRKFGLMKKAYELSVLCD CEIALIIFNS
Predicted Reactivity Dog : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rat : 100 %, Zebrafish : 100 %
Characteristics This is a rabbit polyclonal antibody against MEF2B. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name MEF2B
Background This gene represents numerous read-through transcripts that span geneID:729991 and 100271849. Many read-through transcripts are predicted to be nonsense-mediated decay (NMD) candidates, and are thought to be non-coding. Some transcripts are predicted to be capable of translation reinitation at a downstream AUG, resulting in expression of at least one isoform of myocyte enhancer factor 2B (MEF2B) from this read-through locus.
Molecular Weight 39 kDa
Gene ID 4207
NCBI Accession NM_005919, NP_005910
UniProt Q02080
Research Area Cardiovascular, Hypertrophy, Cardiogenesis, Transcription Factors, Neurogenesis
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 365 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Myocyte Enhancer Factor 2B (MEF2B) (N-Term) antibody WB Suggested Anti-MEF2B Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 293T cell lysate
Product cited in: Gong, Tsai, Yan et al.: "Cooperation between MEF2 and PPARgamma in human intestinal beta,beta-carotene 15,15'-monooxygenase gene expression." in: BMC molecular biology, Vol. 7, pp. 7, 2006 (PubMed).

Hosts (30), (27)
Reactivities (54), (22), (13), (12), (12)
Applications (38), (37), (11), (10), (3), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (11), (7), (3), (3), (2), (2), (1), (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN501723
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top