Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN501738

Structural Maintenance of Chromosomes 1A (SMC1A) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CDLS2, DXS423E, SB1.8, SMC1, SMC1L1, SMC1alpha, SMCB, SMC-1A, 5830426I24Rik, Sb1.8, Smc1, Smc1alpha, Smc1l1, Smcb, mKIAA0178, smc1, smc1a, smc1l1, xSMC1, zgc:76902, im:7158706, SMC1L2, NV15570
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Xenopus laevis, Zebrafish (Danio rerio), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN501738
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SMC1A antibody: synthetic peptide directed towards the C terminal of human SMC1A
Sequence VISLKEEFYTKAESLIGVYPEQGDCVISKVLTFDLTKYPD ANPNPNEQ
Predicted Reactivity Bovine : 100%, Chicken : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Rat : 100%, African clawed frog : 92%, Zebrafish : 76%
Characteristics This is a rabbit polyclonal antibody against SMC1A. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name SMC1A
Background The cohesin multiprotein complex is required for sister chromatid cohesion. This complex is composed partly of two structural maintenance of chromosomes (SMC) proteins, SMC3 and either SMC1L2 or the protein encoded by SMC1A gene. Most of the cohesin complexes dissociate from the chromosomes before mitosis, although those complexes at the kinetochore remain. Therefore, the SMC1A protein is thought to be an important part of functional kinetochores. In addition, this protein interacts with BRCA1 and is phosphorylated by ATM, indicating a potential role for this protein in DNA repair. Proper cohesion of sister chromatids is a prerequisite for the correct segregation of chromosomes during cell division. The cohesin multiprotein complex is required for sister chromatid cohesion. This complex is composed partly of two structural maintenance of chromosomes (SMC) proteins, SMC3 and either SMC1L2 or the protein encoded by this gene. Most of the cohesin complexes dissociate from the chromosomes before mitosis, although those complexes at the kinetochore remain. Therefore, the encoded protein is thought to be an important part of functional kinetochores. In addition, this protein interacts with BRCA1 and is phosphorylated by ATM, indicating a potential role for this protein in DNA repair. This gene, which belongs to the SMC gene family, is located in an area of the X-chromosome that escapes X inactivation.
Molecular Weight 143kDa
Gene ID 8243
NCBI Accession NP_006297, NM_006306
UniProt Q14683
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SMC1A antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Barber, McManus, Yuen et al.: "Chromatid cohesion defects may underlie chromosome instability in human colorectal cancers." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 105, Issue 9, pp. 3443-8, 2008 (PubMed).

Alternatives for antigen "Structural Maintenance of Chromosomes 1A (SMC1A)", type "Antibodies"
Hosts (117), (26), (1), (1)
Reactivities (139), (80), (31), (25), (25), (24), (24), (12), (1), (1), (1)
Applications (107), (42), (41), (33), (30), (16), (14), (8), (8), (3), (1), (1)
Conjugates (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (2)
Epitopes (45), (13), (12), (7), (3), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1)
Beacon