Did you know that you can buy products from over 140 different suppliers from us?

Zinc Finger and BTB Domain Containing 25 (ZBTB25) (Middle Region) antibody

Details for Product No. ABIN501754
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C14orf51, KUP, ZNF46, 2810462M08Rik, 2900064P18Rik, AI842128, Kup, Zfp-50, Zfp50, Znf46
Epitope
Middle Region
(8), (7), (5), (2), (2), (2), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
(22), (2), (2), (2), (2)
Host
Rabbit
(15), (7)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(18), (14), (2), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN501754
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human ZBTB25
Sequence GNALAQRFQPYCDSWSDVSLKSSRLSQEHLDLPCALESEL TQENVDTILV
Predicted Reactivity Mouse : 92 %, Rat : 92 %, Bovine : 72 %, Dog : 72 %
Characteristics This is a rabbit polyclonal antibody against ZBTB25. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZBTB25
Background ZBTB25 contains 1 BTB (POZ) domain and 2 C2H2-type zinc fingers and belongs to the krueppel C2H2-type zinc-finger protein family. ZBTB25 may be involved in transcriptional regulation.
Molecular Weight 49 kDa
Gene ID 7597
NCBI Accession NM_006977, NP_008908
UniProt P24278
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 435 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Zinc Finger and BTB Domain Containing 25 (ZBTB25) (Middle Region) antibody WB Suggested Anti-ZBTB25 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: OVCAR-3 cell lysate
Background publications Lim, Hao, Shaw et al.: "A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration." in: Cell, Vol. 125, Issue 4, pp. 801-14, 2006 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN501754
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top