Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN501803

Zinc Finger Protein 302 (ZNF302) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms HSD16, MST154, MSTP154, ZNF135L, ZNF140L, ZNF327
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Zebrafish (Danio rerio), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN501803
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZNF302 antibody: synthetic peptide directed towards the middle region of human ZNF302
Sequence FCCSSHLTQHQRIHSMKKKYECNKCLKVFSSFSFLVQHQS IHTEEKPFEV
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against ZNF302. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ZNF302
Background ZNF302 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 7 C2H2-type zinc fingers and 1 KRAB domain. ZNF302 may be involved in transcriptional regulation.
Molecular Weight 46kDa
Gene ID 55900
NCBI Accession NP_060913, NM_018443
UniProt Q8NC84
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZNF302 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Abrink, Aveskogh, Hellman: "Isolation of cDNA clones for 42 different Krüppel-related zinc finger proteins expressed in the human monoblast cell line U-937." in: DNA and cell biology, Vol. 14, Issue 2, pp. 125-36, 1995 (PubMed).

Alternatives for antigen "Zinc Finger Protein 302 (ZNF302)", type "Antibodies"
Hosts (11), (2)
Reactivities (13), (2), (2), (2), (2), (1)
Applications (13), (2), (2)
Epitopes (5), (2), (2), (2), (1), (1)
Beacon