Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN501855

Mitochondrial Ribosomal Protein S15 (MRPS15) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms MPR-S15, RPMS15, S15mt, Mprs15, 1500003E24Rik, 2410002B11Rik, CG4207, DmMRPS15, Dmel\\CG4207, MRP-S15, mRpS15, zgc:92862
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN501855
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-MRPS15 antibody: synthetic peptide directed towards the N terminal of human MRPS15
Sequence FNQWGLQPRSLLLQAARGYVVRKPAQSRLDDDPPPSTLLK DYQNVPGIEK
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against MRPS15. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name MRPS15
Background Mammalian mitochondrial ribosomal proteins help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. MRPS15 is a 28S subunit protein that belongs to the ribosomal pr
Molecular Weight 30kDa
Gene ID 64960
NCBI Accession NP_112570, NM_031280
UniProt P82914
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-MRPS15 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Zhang, Gerstein: "Identification and characterization of over 100 mitochondrial ribosomal protein pseudogenes in the human genome." in: Genomics, Vol. 81, Issue 5, pp. 468-80, 2003 (PubMed).

Alternatives for antigen "Mitochondrial Ribosomal Protein S15 (MRPS15)", type "Antibodies"
Hosts (14)
Reactivities (14), (4), (3), (2)
Applications (13), (6), (4), (2), (1)
Epitopes (3), (2), (2), (2), (2), (2), (1)
Beacon