Mitochondrial Ribosomal Protein S15 (MRPS15) (N-Term) antibody

Details for Product No. ABIN501855
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms MPR-S15, RPMS15, S15mt, Mprs15, 1500003E24Rik, 2410002B11Rik, CG4207, DmMRPS15, Dmel\\CG4207, MRP-S15, mRpS15, zgc:92862
Epitope
N-Term
(3), (2), (2), (2), (1)
Reactivity
Human
(13), (5), (4), (2)
Host
Rabbit
(13)
Clonality
Polyclonal
Application
Western Blotting (WB)
(12), (5), (3), (3), (1)
Pubmed 1 reference available
Catalog no. ABIN501855
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human MRPS15
Sequence FNQWGLQPRSLLLQAARGYVVRKPAQSRLDDDPPPSTLLK DYQNVPGIEK
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against MRPS15. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name MRPS15
Background Mammalian mitochondrial ribosomal proteins help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. MRPS15 is a 28S subunit protein that belongs to the ribosomal pr
Molecular Weight 30 kDa
Gene ID 64960
NCBI Accession NM_031280, NP_112570
UniProt P82914
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 257 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Zhang, Gerstein: "Identification and characterization of over 100 mitochondrial ribosomal protein pseudogenes in the human genome." in: Genomics, Vol. 81, Issue 5, pp. 468-80, 2003 (PubMed).

Hosts (13)
Reactivities (13), (5), (4), (2)
Applications (12), (5), (3), (3), (1)
Epitopes (3), (2), (2), (2), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top