Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN501861

Zinc and Ring Finger Protein 1 (ZNRF1) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms NIN283, B830022L21Rik, Rnf42, Zrfp1, nin283, zgc:77896, zrfp1
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Xenopus laevis, Zebrafish (Danio rerio), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN501861
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZNRF1 antibody: synthetic peptide directed towards the N terminal of human ZNRF1
Sequence MGGKQSTAARSRGPFPGVSTDDSAVPPPGGAPHFGHYRTG GGAMGLRSRS
Predicted Reactivity Bovine : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, African clawed frog : 85%, Zebrafish : 85%
Characteristics This is a rabbit polyclonal antibody against ZNRF1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ZNRF1
Background In a study identifying genes in rat that are upregulated in response to nerve damage, a gene which is highly expressed in ganglia and in the central nervous system was found. The protein encoded by the rat gene contains both a zinc finger and a RING finge
Molecular Weight 24kDa
Gene ID 84937
NCBI Accession NP_115644, NM_032268
UniProt Q8ND25
Research Area Proteolysis / Ubiquitin
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZNRF1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Mehrle, Rosenfelder, Schupp et al.: "The LIFEdb database in 2006." in: Nucleic acids research, Vol. 34, Issue Database issue, pp. D415-8, 2005 (PubMed).

Alternatives for antigen "Zinc and Ring Finger Protein 1 (ZNRF1)", type "Antibodies"
Hosts (24), (5), (3)
Reactivities (30), (20), (19), (19), (18), (17), (1), (1), (1)
Applications (15), (13), (10), (9), (6), (2), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (3), (2), (2), (2), (2), (1), (1), (1)
Beacon