Zinc Finger Protein 645 (ZNF645) (Middle Region) antibody

Details for Product No. ABIN501897
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms HAKAIL
Epitope
Middle Region
(2), (1), (1)
Reactivity
Human
(8)
Host
Rabbit
(7), (1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(7), (1)
Pubmed 1 reference available
Catalog no. ABIN501897
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human ZNF645
Sequence LSPQFTQTDAMDHRRWPAWKRLSPCPPTRSPPPSTLHGRS HHSHQRRHRR
Predicted Reactivity Human : 92 %
Characteristics This is a rabbit polyclonal antibody against ZNF645. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZNF645
Background ZNF645 contains 1 RING-type zinc finger, which is probably involved in mediating protein-protein interactions.
Molecular Weight 49 kDa
Gene ID 158506
NCBI Accession NM_152577, NP_689790
UniProt Q8N7E2
Research Area Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 425 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Zinc Finger Protein 645 (ZNF645) (Middle Region) antibody WB Suggested Anti-ZNF645 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: MCF7 cell lysate
Background publications Ross, Grafham, Coffey et al.: "The DNA sequence of the human X chromosome...." in: Nature, Vol. 434, Issue 7031, pp. 325-37, 2005 (PubMed).

Hosts (7), (1)
Reactivities (8)
Applications (7), (1)
Epitopes (2), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top