Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN501897

Zinc Finger Protein 645 (ZNF645) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms HAKAIL
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN501897
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZNF645 antibody: synthetic peptide directed towards the middle region of human ZNF645
Sequence LSPQFTQTDAMDHRRWPAWKRLSPCPPTRSPPPSTLHGRS HHSHQRRHRR
Predicted Reactivity Human : 92%
Characteristics This is a rabbit polyclonal antibody against ZNF645. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ZNF645
Background ZNF645 contains 1 RING-type zinc finger, which is probably involved in mediating protein-protein interactions.
Molecular Weight 49kDa
Gene ID 158506
NCBI Accession NP_689790, NM_152577
UniProt Q8N7E2
Research Area Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZNF645 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Ross, Grafham, Coffey et al.: "The DNA sequence of the human X chromosome." in: Nature, Vol. 434, Issue 7031, pp. 325-37, 2005 (PubMed).

Alternatives for antigen "Zinc Finger Protein 645 (ZNF645)", type "Antibodies"
Hosts (7)
Reactivities (7)
Applications (6)
Epitopes (2), (1), (1)
Beacon