Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN501930

Actin, beta (ACTB) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms
ACTA1, A, ACT5C, Ac5C, Act, Act-5C, Act5, Act5c, Actin, Actin/BAP47, Actin5C, BAP47, Bap47, CG4027, Dmel\\CG4027, M32055, T11, act, act 5C, act5C, actin, actin5C, anon-EST:fe2D2, beta-actin, beta-acti ... show more
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN501930
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for Anti-ACTB antibody is: synthetic peptide directed towards the middle region of Human ACTB
Sequence TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYD ESGPSIVHRK
Predicted Reactivity African clawed frog : 100%, Bovine : 100%, Chicken : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%, Sheep : 100%, Zebrafish : 100%
Characteristics This is a rabbit polyclonal antibody against ACTB. It was validated on Western Blot. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Affinity Purified
Alternative Name ACTB
Background This protein is one of six different actin proteins. Actins are highly conserved proteins that are involved in cell motility, structure, and integrity. This actin is a major constituent of the contractile apparatus and one of the two nonmuscle cytoskeletal actins.
Molecular Weight 42kDa
Gene ID 60
NCBI Accession NP_001092, NM_001101
UniProt P60709
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final Anti-ACTB antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Rinne, Clements, Lamme et al.: "A novel translation re-initiation mechanism for the p63 gene revealed by amino-terminal truncating mutations in Rapp-Hodgkin/Hay-Wells-like syndromes." in: Human molecular genetics, Vol. 17, Issue 13, pp. 1968-77, 2008 (PubMed).

Alternatives for antigen "Actin, beta (ACTB)", type "Antibodies"
Hosts (206), (126), (21), (2), (2)
Reactivities (323), (195), (177), (73), (59), (58), (45), (31), (30), (25), (24), (19), (17), (13), (11), (6), (5), (4), (4), (3), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Applications (314), (134), (99), (69), (53), (51), (33), (20), (18), (17), (10), (4), (4), (3), (2), (2), (1), (1)
Conjugates (14), (11), (5), (4), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (95), (23), (12), (9), (6), (4), (4), (3), (2), (2), (2), (2), (1), (1)
Beacon