Actin, beta (ACTB) (Middle Region) antibody

Details for Product No. ABIN501930
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms
ACTA1, A, ACT5C, Ac5C, Act, Act-5C, Act5, Act5c, Actin, Actin/BAP47, Actin5C, BAP47, Bap47, CG4027, Dmel\\CG4027, M32055, T11, act, act 5C, act5C, actin, actin5C, anon-EST:fe2D2, beta-actin, beta-acti ... show more
ACTA1, A, ACT5C, Ac5C, Act, Act-5C, Act5, Act5c, Actin, Actin/BAP47, Actin5C, BAP47, Bap47, CG4027, Dmel\\CG4027, M32055, T11, act, act 5C, act5C, actin, actin5C, anon-EST:fe2D2, beta-actin, beta-actin/Bap47, cyt5C, l(1)G0009, l(1)G0010, l(1)G0025, l(1)G0079, l(1)G0117, l(1)G0177, l(1)G0245, l(1)G0330, l(1)G0420, l(1)G0486, BRWS1, PS1TP5BP1, Actx, E430023M04Rik, Bact, ACT-5, A26C1B, ACTB, POTE2alpha, POTEACTIN, actb, ps1tp5bp1, LOC563571, A26C1A, act-2, B-actin, LOC100136013, LOC100174883, LOC100304816 show less
Epitope
Middle Region
(96), (29), (12), (9), (7), (4), (4), (3), (3), (2), (2), (2), (1), (1), (1)
Reactivity
Human
(321), (197), (182), (69), (54), (51), (40), (30), (29), (27), (23), (22), (11), (11), (9), (9), (7), (4), (4), (3), (3), (3), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Host
Rabbit
(206), (129), (18), (2)
Clonality
Polyclonal
Conjugate
Un-conjugated
(12), (10), (4), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(313), (138), (88), (62), (60), (51), (27), (20), (19), (10), (9), (5), (4), (3), (2), (2), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN501930
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen The immunogen for Anti-ACTB antibody is: synthetic peptide directed towards the middle region of Human ACTB
Sequence TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYD ESGPSIVHRK
Predicted Reactivity African clawed frog : 100 %, Bovine : 100 %, Chicken : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, Rat : 100 %, Sheep : 100 %, Zebrafish : 100 %
Characteristics This is a rabbit polyclonal antibody against ACTB. It was validated on Western Blot.
Purification Affinity Purified
Alternative Name ACTB
Background This protein is one of six different actin proteins. Actins are highly conserved proteins that are involved in cell motility, structure, and integrity. This actin is a major constituent of the contractile apparatus and one of the two nonmuscle cytoskeletal actins.
Molecular Weight 42 kDa
Gene ID 60
NCBI Accession NM_001101, NP_001092
UniProt P60709
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 375 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Actin, beta (ACTB) (Middle Region) antibody WB Suggested Anti-ACTB Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Transfected 293T
anti-Actin, beta (ACTB) (Middle Region) antibody (2) Sample type: 1-8.N2 WT C elegans (60ug)
Primary Dilution: 1:2000
Secondary Antibody: goat anti-Rabbit HRP
Secondary Dilution: 1:2000

anti-Actin, beta (ACTB) (Middle Region) antibody (3) Sample Type: NT2 cells
Red: Antibody
Blue: DAPI
Primary Dilution: 1ug/50ul antibody
Secondary Antibody: Alexa goat anti-rabbit 594
Image Submitted by: Yuzhi Chen, University of Arkansas for Medical Sciences
Product cited in: Rinne, Clements, Lamme et al.: "A novel translation re-initiation mechanism for the p63 gene revealed by amino-terminal truncating mutations in Rapp-Hodgkin/Hay-Wells-like syndromes." in: Human molecular genetics, Vol. 17, Issue 13, pp. 1968-77, 2008 (PubMed).

Hosts (206), (129), (18), (2)
Reactivities (321), (197), (182), (69), (54), (51), (40), (30), (29), (27), (23), (22), (11), (11), (9), (9), (7), (4), (4), (3), (3), (3), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Applications (313), (138), (88), (62), (60), (51), (27), (20), (19), (10), (9), (5), (4), (3), (2), (2), (1), (1)
Conjugates (12), (10), (4), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1)
Epitopes (96), (29), (12), (9), (7), (4), (4), (3), (3), (2), (2), (2), (1), (1), (1)
back to top