Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN501957

Dyskeratosis Congenita 1, Dyskerin (DKC1) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms
CBF5, DKC, DKCX, NAP57, NOLA4, XAP101, dyskerin, BC068171, Nap57, AtCBF5, AtNAP57, homologue of NAP57, fv62a07, wu:fa28f10, wu:fc87a02, wu:fi24a05, wu:fv62a07, zgc:110395, DKC1, cbf5, dkc, nap57, nola ... show more
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Rabbit, Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Pig (Porcine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN501957
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-DKC1 antibody: synthetic peptide directed towards the N terminal of human DKC1
Sequence EFLIKPESKVAKLDTSQWPLLLKNFDKLNVRTTHYTPLAC GSNPLKREIG
Predicted Reactivity Bovine : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Pig : 100%, Rabbit : 100%, Sheep : 100%, Chicken : 92%, Mouse : 92%, Rat : 92%, Zebrafish : 85%
Characteristics This is a rabbit polyclonal antibody against DKC1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name DKC1
Background This gene is a member of the H/ACA snoRNPs (small nucleolar ribonucleoproteins) gene family. snoRNPs are involved in various aspects of rRNA processing and modification and have been classified into two families: C/D and H/ACA. The H/ACA snoRNPs also incl
Molecular Weight 58kDa
Gene ID 1736
NCBI Accession NP_001354, NM_001363
UniProt O60832
Research Area Chromatin and Nuclear Signaling, Chromatin Binding Proteins, DNA/RNA
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-DKC1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Machado-Pinilla, Sánchez-Pérez, Murguía et al.: "A dyskerin motif reactivates telomerase activity in X-linked dyskeratosis congenita and in telomerase-deficient human cells." in: Blood, Vol. 111, Issue 5, pp. 2606-14, 2008 (PubMed).

Alternatives for antigen "Dyskeratosis Congenita 1, Dyskerin (DKC1)", type "Antibodies"
Hosts (31), (8), (1)
Reactivities (38), (28), (22), (12), (12), (12), (12)
Applications (25), (14), (12), (11), (10), (8), (2), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (7), (2), (1), (1), (1), (1), (1)
Beacon