Dyskeratosis Congenita 1, Dyskerin (DKC1) (N-Term) antibody

Details for Product No. ABIN501957
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms
CBF5, DKC, DKCX, NAP57, NOLA4, XAP101, dyskerin, BC068171, Nap57, AtCBF5, AtNAP57, homologue of NAP57, fv62a07, wu:fa28f10, wu:fc87a02, wu:fi24a05, wu:fv62a07, zgc:110395, DKC1, cbf5, dkc, nap57, nola ... show more
CBF5, DKC, DKCX, NAP57, NOLA4, XAP101, dyskerin, BC068171, Nap57, AtCBF5, AtNAP57, homologue of NAP57, fv62a07, wu:fa28f10, wu:fc87a02, wu:fi24a05, wu:fv62a07, zgc:110395, DKC1, cbf5, dkc, nap57, nola4, xap101 show less
Epitope
N-Term
(7), (2), (1), (1), (1), (1), (1), (1)
Reactivity
Rabbit, Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Pig (Porcine), Human, Chicken
(40), (31), (26), (12), (12), (12), (12)
Host
Rabbit
(34), (7), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(27), (16), (15), (10), (10), (8), (6), (1)
Pubmed 1 reference available
Catalog no. ABIN501957
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human DKC1
Sequence EFLIKPESKVAKLDTSQWPLLLKNFDKLNVRTTHYTPLAC GSNPLKREIG
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Pig : 100 %, Rabbit : 100 %, Sheep : 100 %, Chicken : 90 %, Mouse : 90 %, Rat : 90 %, Zebrafish : 80 %
Characteristics This is a rabbit polyclonal antibody against DKC1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name DKC1
Background This gene is a member of the H/ACA snoRNPs (small nucleolar ribonucleoproteins) gene family. snoRNPs are involved in various aspects of rRNA processing and modification and have been classified into two families: C/D and H/ACA. The H/ACA snoRNPs also incl
Molecular Weight 58 kDa
Gene ID 1736
NCBI Accession NM_001363, NP_001354
UniProt O60832
Research Area Chromatin and Nuclear Signaling, Chromatin Binding Proteins, DNA/RNA
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 514 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Machado-Pinilla, Sánchez-Pérez, Murguía et al.: "A dyskerin motif reactivates telomerase activity in X-linked dyskeratosis congenita and in telomerase-deficient human cells." in: Blood, Vol. 111, Issue 5, pp. 2606-14, 2008 (PubMed).

Hosts (34), (7), (1)
Reactivities (40), (31), (26), (12), (12), (12), (12)
Applications (27), (16), (15), (10), (10), (8), (6), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (7), (2), (1), (1), (1), (1), (1), (1)
back to top