Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Polypyrimidine Tract Binding Protein 2 (PTBP2) antibody

Antigen

Polypyrimidine Tract Binding Protein 2 (PTBP2)

Synonyms PTB, nPTB, PTBLP, brPTB, nPTB5, nPTB6, nPTB7, nPTB8, FLJ34897, Ptb2, MGC95244, PTBP2, MGC139378, ptbp2, wu:fa08f05, wu:fc05d10, si:ch211-160l17.2
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Zebrafish

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN502048
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name PTBP2
Gene ID PTBP2
UniProt Q9UKA9
Immunogen The immunogen for anti-PTBP2 antibody: synthetic peptide directed towards the N terminal of human PTBP2
Sequence AITMVNYYSAVTPHLRNQPIYIQYSNHKELKTDNTLNQRA QAVLQAVTAV
Cross-Reactivity Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-PTBP2 antibody concentration is 1 mg/ml.
Description The protein encoded by this gene binds to the intronic cluster of RNA regulatory elements, downstream control sequence (DCS). It is implicated in controlling the assembly of other splicing-regulatory proteins. This protein is very similar to the polypyrim
Characteristics Antigen Size: 531 amino acids
Molecular Weight 57kDa

Application Details

Application Notes WB Suggested Anti-PTBP2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: PANC1 cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Chromatin and Nuclear Signaling, Chromatin Binding Proteins, DNA/RNA
Restrictions For Research Use only

Publications

Product Galbán, Kuwano, Pullmann et al.: "RNA-binding proteins HuR and PTB promote the translation of hypoxia-inducible factor 1alpha." in: Molecular and cellular biology, Vol. 28, Issue 1, pp. 93-107, 2007 (PubMed).

Alternatives

Alternatives for antigen "Polypyrimidine Tract Binding Protein 2 (PTBP2)", type "Antibodies"
Hosts Rabbit (24), Goat (3), Mouse (3)
Reactivities Human (26), Cow (Bovine) (19), Dog (Canine) (19), Mouse (Murine) (19), Rat (Rattus) (19), Zebrafish (Danio rerio) (18)
Applications Immunofluorescence (IF) (15), Western Blotting (WB) (12), ELISA (9), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (4), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunoelectron Microscopy (IEM) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1)
Epitopes N-Term (2), Internal Region (1)