Phosphatidylinositol Glycan Anchor Biosynthesis, Class Z (PIGZ) antibody

Antigen: Phosphatidylinositol Glycan Anchor Biosynthesis, Class Z (PIGZ)

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Dog (Canine), Fruit Fly (Drosophila melanogaster)

Application: Western Blotting (WB)

Catalog no.: ABIN502056

Additional Information

Alternative name: PIGZ

Gene ID: PIGZ

Immunogen: The immunogen for anti-PIGZ antibody: synthetic peptide directed towards the N terminal of human PIGZ

Sequence: VLWGGLSLLRVLWCLLPQTGYVHPDEFFQSPEVMAEDILG VQAARPWEFY

Cross-Reactivity: Cow (Bovine), Dog (Canine), Fruit Fly (Drosophila melanogaster), Human, Mouse (Murine)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-PIGZ antibody concentration is 1 mg/ml.

Description: The glycosylphosphatidylinositol (GPI) anchor is a glycolipid found on many blood cells that serves to anchor proteins to the cell surface. PIGZ is a protein that is localized to the endoplasmic reticulum, and is involved in GPI anchor biosynthesis. As shown for the yeast homolog, which is a member of a family of dolichol-phosphate-mannose (Dol-P-Man)-dependent mannosyltransferases, this protein can also add a side-branching fourth mannose to GPI precursors during the assembly of GPI anchors.The glycosylphosphatidylinositol (GPI) anchor is a glycolipid found on many blood cells that serves to anchor proteins to the cell surface. This gene encodes a protein that is localized to the endoplasmic reticulum, and is involved in GPI anchor biosynthesis. As shown for the yeast homolog, which is a member of a family of dolichol-phosphate-mannose (Dol-P-Man)-dependent mannosyltransferases, this protein can also add a side-branching fourth mannose to GPI precursors during the assembly of GPI anchors.

Characteristics: Antigen Size: 579 amino acids

Molecular Weight: 63kDa

Application Details

Application Notes: WB Suggested Anti-PIGZ Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Hela cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-PIGZ Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Hela cell lysate

Publications

Product: Taron, Colussi, Wiedman et al.: "Human Smp3p adds a fourth mannose to yeast and human glycosylphosphatidylinositol precursors in vivo." in: The Journal of biological chemistry, Vol. 279, Issue 34, pp. 36083-92, 2004 (PubMed).