Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502063

Poly(A) Binding Protein, Cytoplasmic 5 (PABPC5) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C820015E17, PABP5, PABPC5
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502063
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-PABPC5 antibody: synthetic peptide directed towards the N terminal of human PABPC5
Sequence DAEWALNTMNFDLINGKPFRLMWSQPDDRLRKSGVGNIFI KNLDKSIDNR
Predicted Reactivity Horse : 100%, Mouse : 100%, Rabbit : 100%, Bovine : 92%, Rat : 92%
Characteristics This is a rabbit polyclonal antibody against PABPC5. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name PABPC5
Background PABPC5 binds the poly(A) tail of mRNA. PABPC5 may be involved in cytoplasmic regulatory processes of mRNA metabolism. PABPC5 can probably bind to cytoplasmic RNA sequences other than poly(A) in vivo.
Molecular Weight 43kDa
Gene ID 140886
NCBI Accession NP_543022, NM_080832
UniProt Q96DU9
Research Area Chromatin and Nuclear Signaling, Chromatin Binding Proteins, DNA/RNA
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-PABPC5 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Ross, Grafham, Coffey et al.: "The DNA sequence of the human X chromosome." in: Nature, Vol. 434, Issue 7031, pp. 325-37, 2005 (PubMed).

Alternatives for antigen "Poly(A) Binding Protein, Cytoplasmic 5 (PABPC5)", type "Antibodies"
Hosts (13), (1)
Reactivities (13)
Applications (14), (9), (1)
Epitopes (5), (1), (1)
Beacon