Poly(A) Binding Protein, Cytoplasmic 5 (PABPC5) (N-Term) antibody

Details for Product No. ABIN502063
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms C820015E17, PABP5, PABPC5
Epitope
N-Term
(3), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Human
(12)
Host
Rabbit
(13)
Clonality
Polyclonal
Application
Western Blotting (WB)
(13), (9)
Pubmed 1 reference available
Catalog no. ABIN502063
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human PABPC5
Sequence DAEWALNTMNFDLINGKPFRLMWSQPDDRLRKSGVGNIFI KNLDKSIDNR
Predicted Reactivity Horse : 100 %, Mouse : 100 %, Rabbit : 100 %, Bovine : 90 %, Rat : 90 %
Characteristics This is a rabbit polyclonal antibody against PABPC5. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name PABPC5
Background PABPC5 binds the poly(A) tail of mRNA. PABPC5 may be involved in cytoplasmic regulatory processes of mRNA metabolism. PABPC5 can probably bind to cytoplasmic RNA sequences other than poly(A) in vivo.
Molecular Weight 43 kDa
Gene ID 140886
NCBI Accession NM_080832, NP_543022
UniProt Q96DU9
Research Area Chromatin and Nuclear Signaling, Chromatin Binding Proteins, DNA/RNA
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 382 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Poly(A) Binding Protein, Cytoplasmic 5 (PABPC5) (N-Term) antibody WB Suggested Anti-PABPC5 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: NCI-H226 cell lysate
Background publications Ross, Grafham, Coffey et al.: "The DNA sequence of the human X chromosome...." in: Nature, Vol. 434, Issue 7031, pp. 325-37, 2005 (PubMed).

Hosts (13)
Reactivities (12)
Applications (13), (9)
Epitopes (3), (1), (1), (1)
back to top