PABPC5 antibody

Catalog No. ABIN633413

Product Details anti-PABPC5 Antibody

Target: PABPC5 (Poly(A) Binding Protein, Cytoplasmic 5 (PABPC5))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PABPC5 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: PABPC5 antibody was raised using a synthetic peptide corresponding to a region with amino acids DAEWALNTMNFDLINGKPFRLMWSQPDDRLRKSGVGNIFIKNLDKSIDNR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PABPC5 Blocking Peptide, catalog no. 33R-1849, is also available for use as a blocking control in assays to test for specificity of this PABPC5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PABPC5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PABPC5

Target: PABPC5 (Poly(A) Binding Protein, Cytoplasmic 5 (PABPC5))

Alternative Name: PABPC5 (PABPC5 Products)

Synonyms: PABPC5 antibody, PABP5 antibody, C820015E17 antibody, poly(A) binding protein cytoplasmic 5 antibody, poly A binding protein, cytoplasmic 5 antibody, poly(A) binding protein, cytoplasmic 5 antibody, PABPC5 antibody, Pabpc5 antibody

Background: PABPC5 binds the poly(A) tail of mRNA. PABPC5 may be involved in cytoplasmic regulatory processes of mRNA metabolism. PABPC5 can probably bind to cytoplasmic RNA sequences other than poly(A) in vivo.

Molecular Weight: 43 kDa (MW of target protein)