Did you know that you can buy products from over 140 different suppliers from us?

WD Repeat Domain 8 (WDR8) (Middle Region) antibody

Details for Product No. ABIN502087
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms fi45a07, zgc:56287, wu:fi45a07, Wdr8, MGC75994, WDR8, MGC85022, 2610044M17Rik, 5330425N03Rik, Dd57
Epitope
Middle Region
(2), (1), (1), (1)
Reactivity
Human
(4), (2)
Host
Rabbit
(6)
Clonality
Polyclonal
Application
Western Blotting (WB)
(6)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN502087
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human WDR8
Sequence GCLSFPPPRAGAGPLPSSESKYEIASVPVSLQTLKPVTDR ANPKMGIGML
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against WDR8. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name WDR8
Background This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein com
Molecular Weight 51 kDa
Gene ID 49856
NCBI Accession NM_017818, NP_060288
UniProt Q9P2S5
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 460 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Product cited in: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Validation Images
back to top