WDR8 antibody (Middle Region)

Catalog No. ABIN631094

Product Details anti-WDR8 Antibody

Target: WDR8 (WD Repeat Domain 8 (WDR8))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This WDR8 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: WDR8 antibody was raised against the middle region of WDR8

Purification: Affinity purified

Immunogen: WDR8 antibody was raised using the middle region of WDR8 corresponding to a region with amino acids GCLSFPPPRAGAGPLPSSESKYEIASVPVSLQTLKPVTDRANPKMGIGML

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

WDR8 Blocking Peptide, catalog no. 33R-3188, is also available for use as a blocking control in assays to test for specificity of this WDR8 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDR8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for WDR8

Target: WDR8 (WD Repeat Domain 8 (WDR8))

Alternative Name: WDR8 (WDR8 Products)

Synonyms: fi45a07 antibody, zgc:56287 antibody, wu:fi45a07 antibody, Wdr8 antibody, MGC75994 antibody, WDR8 antibody, MGC85022 antibody, 2610044M17Rik antibody, 5330425N03Rik antibody, Dd57 antibody, WD repeat containing, antisense to TP73 antibody, WD repeat containing, antisense to TP73 L homeolog antibody, WD repeat containing, antisense to Trp73 antibody, wrap73 antibody, Wrap73 antibody, WRAP73 antibody, wrap73.L antibody

Background: This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD).

Molecular Weight: 51 kDa (MW of target protein)