Did you know that you can buy products from over 140 different suppliers from us?

Fibulin 3 (FBLN3) (Middle Region) antibody

Details for Product No. ABIN502093
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms DHRD, DRAD, FBLN3, FBNL, FIBL-3, MLVT, MTLV, S1-5, T16
Epitope
Middle Region
(10), (9), (8), (5), (4), (2), (2), (1), (1), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human, Chicken
(45), (24), (20), (3), (2), (2), (2), (1)
Host
Rabbit
(52), (4)
Clonality
Polyclonal
Conjugate
Un-conjugated
(4), (2), (1), (1), (1), (1)
Application
Western Blotting (WB)
(52), (32), (15), (13), (12), (10), (6), (3), (2), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN502093
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human EFEMP1
Sequence GNENGEFYLRQTSPVSAMLVLVKSLSGPREHIVDLEMLTV SSIGTFRTSS
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, Rat : 100 %, Chicken : 90 %, Guinea pig : 90 %
Characteristics This is a rabbit polyclonal antibody against EFEMP1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name EFEMP1
Background EFEMP1 gene spans approximately 18 kb of genomic DNA and consists of 12 exons. Alternative splice patterns in the 5' UTR result in three transcript variants encoding the same extracellular matrix protein. Mutations in this gene are associated with Doyne h
Molecular Weight 53 kDa
Gene ID 2202
NCBI Accession NM_004105, NP_004096
UniProt Q12805
Research Area Neurology
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 493 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Fibulin 3 (FBLN3) (Middle Region) antibody WB Suggested Anti-EFEMP1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: HT1080 cell lysate
Background publications Weedon, Lango, Lindgren et al.: "Genome-wide association analysis identifies 20 loci that influence adult height." in: Nature genetics, Vol. 40, Issue 5, pp. 575-83, 2008 (PubMed).

Hosts (52), (4)
Reactivities (45), (24), (20), (3), (2), (2), (2), (1)
Applications (52), (32), (15), (13), (12), (10), (6), (3), (2), (1)
Conjugates (4), (2), (1), (1), (1), (1)
Epitopes (10), (9), (8), (5), (4), (2), (2), (1), (1), (1), (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN502093
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top