Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502093

Fibulin 3 (FBLN3) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms DHRD, DRAD, FBLN3, FBNL, FIBL-3, MLVT, MTLV, S1-5, T16
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502093
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-EFEMP1 antibody: synthetic peptide directed towards the middle region of human EFEMP1
Sequence GNENGEFYLRQTSPVSAMLVLVKSLSGPREHIVDLEMLTV SSIGTFRTSS
Predicted Reactivity Bovine : 100%, Dog : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%, Chicken : 92%, Guinea pig : 92%
Characteristics This is a rabbit polyclonal antibody against EFEMP1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name EFEMP1
Background EFEMP1 gene spans approximately 18 kb of genomic DNA and consists of 12 exons. Alternative splice patterns in the 5' UTR result in three transcript variants encoding the same extracellular matrix protein. Mutations in this gene are associated with Doyne h
Molecular Weight 53kDa
Gene ID 2202
NCBI Accession NP_004096, NM_004105
UniProt Q12805
Research Area Neurology
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-EFEMP1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Weedon, Lango, Lindgren et al.: "Genome-wide association analysis identifies 20 loci that influence adult height." in: Nature genetics, Vol. 40, Issue 5, pp. 575-83, 2008 (PubMed).

Alternatives for antigen "Fibulin 3 (FBLN3)", type "Antibodies"
Hosts (41), (3)
Reactivities (36), (21), (17), (3), (2), (2), (2), (1)
Applications (40), (19), (10), (8), (6), (5), (4), (2), (1), (1), (1)
Conjugates (3), (1)
Epitopes (9), (4), (4), (2), (2), (2), (2), (1), (1), (1), (1), (1)
Beacon